SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_04507--XP_392764.1_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_04507--XP_392764.1_APIME
Domain Number 1 Region: 46-84
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cflo_04507--XP_392764.1_APIME
Sequence length 201
Comment [mRNA] [translate_table: standard]
Sequence
MVRRFCNGAVALGIALTACAAFPRAIMAIDLSRFYGHINTKRSDACHPYEPFKCPGDGLC
ISIQYLCDGAPDCQDGYDEDSRLCTAAKRPPVEETATFLQSLLASHGPNYLEKLFGNKAR
DTLKPLGGVEKVAIALSESQTIEDFGAALHLMRSDLEHLRSVFMAVENGDLGMLKSIGIK
DSELGDVKFFLEKLVKTGFLD
Download sequence
Identical sequences E2AX35
Cflo_04507--XP_392764.1_APIME XP_011265599.1.72520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]