SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_05295--XP_391993.2_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_05295--XP_391993.2_APIME
Domain Number 1 Region: 119-287,350-378
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.48e-17
Family Type II chitinase 0.0069
Further Details:      
 
Domain Number 2 Region: 2165-2280
Classification Level Classification E-value
Superfamily TNF-like 0.000000000000146
Family TNF-like 0.0044
Further Details:      
 
Domain Number 3 Region: 522-589
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000288
Family Tachycitin 0.016
Further Details:      
 
Domain Number 4 Region: 452-508
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000445
Family Tachycitin 0.015
Further Details:      
 
Domain Number 5 Region: 2055-2115
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000602
Family Tachycitin 0.0091
Further Details:      
 
Weak hits

Sequence:  Cflo_05295--XP_391993.2_APIME
Domain Number - Region: 308-350
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.00238
Family Chitinase insertion domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cflo_05295--XP_391993.2_APIME
Sequence length 2281
Comment [mRNA] [translate_table: standard]
Sequence
MLNLPRIILRFAFLREATSRVHAKRLVQQQSQLNAPVTGAMMTTIETPVASPLSHTSCLT
RAKSNERSCSVVECPKKRTSPIREILCYTSALDAQLLADSICSCTTLVHQHHDIRDLSIS
DIADLQKSLKEMHPPLQFIISIHDPEMTLRNSTIVRQEAVARIMSVINEVDGVEMNVTAG
SKERLYNFIKNLKDEMIRKSYDKRIFLTLPIKAEDLAKQFDMKELVKYVDLFTLPTDYMT
DEDEAFVTFHPSRLMGLFDMLNTDSLVDLISELGAPKHKIMMTLPANAYRFALKHEAENA
PRSQTTEKEPTSIDREQLCEAINDGEWTVERDEDLTAPYAFQNETWIAFEDKISVGIKAK
YALLRDLAGLAVRDVENDVKTECEMPLTEEIYRSFTEFKRKSRQAVLNALEEDLHQTQFS
YPNKAKTSSFRVVRVVDTEGQIRAVRENTQTEFICRRQGYFVHPKSCNRFYRCVKFNQAI
EDYSVFEFDCPAGLSFDERTEVCVWPGSLPQGSPCPGSSEIAPVTPKRFECSQPGYYADP
QNCRWFFACMDLGESQLMAFEFRCPYDLVFDEKKLVCEWPWLVPACSGSGSAYTRTEYYG
GHTAAGSSTGGATGGYITGGLPEYSVTGHSNIDYSKAGTGVQGVSYFTGSTGKHASGADA
VSGYVGSPGAIGIDYSKPGYRGTVPSIPTYTGPSIYFDSISPAGKSSTGYSASGSKISST
GSTGYRVDGGYSGGYTAPLRRVTTGFSGSTAGGYSGTAGGSHLTGGGAIYSDKPEPSYSA
AGGYTASSGYSGGYTASGGITAGSTAEGYSGTAGGSHLTGGGTIYSGRPSYSAAGEYTGS
VDASKPIVVTYPKTGYFASTESPGSSVNIRVDSGPKYVGSTGSSGSIDVDYSKPGYGGTV
SSIPTYTGPSSIYFDSISPAGKSSTGYSASGSKISSTGSTGYRVDGGYSGGYTAPLRRVT
TGFSGSTAGGYSGTAGGSHLTGGGAIYSGRPESSYSATGGYTGSVDASKPIVVTYPKTGY
FASTESPGSPVNIGVDSTGPKYVGSTNLYTSSGAFNADGYSASPGIYSGVSRQPSFDKTG
SAFGIGSSYPGAIDGQSTAKIYEGSIGTGYSKATSGILQGSTSSDRASSATHFGSDASKS
ITSGISAASGHTDATITDSRYFGSGSVPSSGVAGASPTRYGEEGYTVPVFLLHGEPTYPL
IRPTGAEIKNHTGIPGVIRDYAKPDLVRPNLNISIFGNEIPTSYDIPKGGTIVTGSGVQG
SIFTDSTSGTVFRSGNIPGATSSPVIHEGTILTGGVQPGYIASATPQPGYVITDDLKTAN
IGSASPGTLIYGSPTPAISVPGPSSGVDLKGDITPGIVISGQTAPGVSIGSAAQPGIETS
TIKSYVSQAGTTYHGGAATRGCSSYPGEGLTPTRPQGYKPDGGCGINTAYDTGKYSESDV
PDYRPTSATLPDSIVPGGRIEGISNVIFGPTSQGSTTAAPGYSSPTSAVFTPSGFTKTGL
TRTGITTAILGGGGSYSVSTSERRPAYPENISEKAFEGAGYTKISSSSNAADLSVTSTPP
GYFSTASPSRITQRVQSATSGYSYPKPNVQLGTSGITFTPSSSIENNLPITSPKPFSSIN
VDDGSGGINVAFGSKIPTVPADRRLSTSTVSPVIYTTKRPEIYKTTLFEAAKVPVSTFRP
IIDTGYRTVTAPLNNPFLAGQFVQQTGSSQAASTSNIDLGSSFQQTDFSSKKDYGSSLVS
EEYLPAKASTKPGVIASTTRYEVPEVTVRPDNVGITYKEPSSFAYKGPSSITSPTTFRPS
NVYYTGQGFSSSTETTSSGSPTNLDISRDKIDKLITNYNRGTVKYMSNVYDTTAISGFGS
TAKKFSSPGSTTSSYEVATKSLEDKGKVIVKWSDLHPLLLGKLGAECTCKADPFATLRGP
VRKLIASSKGKVDLANYDSSEIYVDLENSSSSEEVSSSEEEVYDGFPAQPYKISPHETST
NQPSSSYLPVASTTVSTRDFVPKGFRTESFTGNAPFGVNLGFRTGRKLKDVDSSPNSIAE
DDLEEDPDQIINGATDCARPGLFRHPSLCNKFYACHWDQWKKKFTLHIFNCPIHLTFDSK
ASACNWPSKGPACQADNLLVVVWAVLILVAVALTDAAVPDPPENPGITTIGSKKLATAAD
CAGVVAFSATQGSVNEAKLVLSETLVDKGVGYAAETGIFTTHCPGLYQFSFAGYGSPDLR
LTLKRKLNKSDSWRPIVSVGTGGGSNLVLLDVEAGDQLAVFVESGKITDGATFTGHRVYK
R
Download sequence
Identical sequences E2ASU5
Cflo_05295--XP_391993.2_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]