SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_05467--XP_001120871.1_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_05467--XP_001120871.1_APIME
Domain Number 1 Region: 2014-2277
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.13e-76
Family Eukaryotic proteases 0.00024
Further Details:      
 
Domain Number 2 Region: 1882-1990
Classification Level Classification E-value
Superfamily SRCR-like 9.81e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 
Domain Number 3 Region: 1736-1840
Classification Level Classification E-value
Superfamily SRCR-like 8.76e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00072
Further Details:      
 
Domain Number 4 Region: 1482-1564
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-19
Family Kringle modules 0.0013
Further Details:      
 
Domain Number 5 Region: 301-360
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 9.15e-18
Family Tachycitin 0.01
Further Details:      
 
Domain Number 6 Region: 386-448
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 2.22e-17
Family Tachycitin 0.01
Further Details:      
 
Domain Number 7 Region: 474-536
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 2.33e-16
Family Tachycitin 0.011
Further Details:      
 
Domain Number 8 Region: 1210-1317
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000222
Family Scavenger receptor cysteine-rich (SRCR) domain 0.004
Further Details:      
 
Domain Number 9 Region: 1320-1478
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000000337
Family C-type lectin domain 0.0047
Further Details:      
 
Domain Number 10 Region: 223-280
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000102
Family Tachycitin 0.0094
Further Details:      
 
Domain Number 11 Region: 1576-1614
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 12 Region: 1615-1690
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00000000298
Family Hairpin loop containing domain 0.028
Further Details:      
 
Domain Number 13 Region: 1844-1882
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 14 Region: 1696-1729
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cflo_05467--XP_001120871.1_APIME
Sequence length 2282
Comment [mRNA] [translate_table: standard]
Sequence
MMSFRLLTLLLLVYCCHLISATKRIRVIYDPSATTTKPPERRESILPWNVIQNKSRIQIE
SPSSKWQQQSRGNIPPKSDTKNWSPWRKPSGSEIEQRTQLENYGPVQVPEQISENIPEQQ
HNLKFDKLDQQNLKPIEYRDFTNNFENESKYGYRNRPQNEIDFDHKHPQRNDNNKELNVG
LQNEDLYEGVAIDSTKPRKENIVLSHNPRHKVAKYDSRLGVQCPDHNSTGQFVYPPDCKF
FVNCWQGRAFVQPCAPNTHFNPDTLECDFPHKVKCYENEFADFRQSLDSESQINRKSQKL
TEPKCPPYLIGLLPHYGDCTKFIQCANGVTYIMDCGPGTVFNPTIGVCDWPRNVKGCEDN
FKSDEDDKMPFAPINPNFGRDKSPYIEVKKITCPADFTGLLAHPETCKKFLQCANGITYI
MDCGPGTVFNPTIGVCDWPRNVKGCEDNFKSDEDDKMPFAPINPNFGRDKSPYIEVKKIT
CPADFTGLLAHPETCKKFLQCANGVTYIMDCGPGTAFNPITTVCDWPYNVPSCKTDKSDG
VYKTGASTWSPSAEARGTMSWSNSGHYNRTTNTRGHISQSKYRYSTTMNPTFRPTWRPFT
TTTPRIRWIPTWTTARPFYNHSKHIPDYHDRYDNVHEEKQYKGHGSHHLEWKPSENLGRP
SGSNYGSQHHPDWQQVGNDQEPQGTYHTDRPEESSVHAYKNPDYHYSHYPSGVHHHHHHH
HHYHNYGPTSNPSEDTNWANPAVTNDQKYNQGYYTPNTDSNWRPSYNYDHNSRHYDHRHF
EHTALNKTDQRQFQLPERNDEDNIQFHHRYNETKFDSDGMSTNQKTDHDFSLNRQNYGRT
IPGLYHPNFNRTSSSVGNIFPNSNNKSTENWDQIQDGLRQDKQSSAWIGQENIGSAWNQP
SRSNFKPSTWHSQENPGNVQTENQTHPWDQGTISQTDKSFSQSTIDKEADTKMTQWATRT
NVFLNSKSQVNLAESKSTTQYPRTNLYPNGIYVNAGGIKGHYITKDIENNEGGLRIHEPY
NVHKPISWNNTFNSTDSNYASFTTETPMTTTPQNISNKQSELSRRGRDFVNITTESELHN
FDHTNEDNLPDVSIERDDYWGASDTKISNVDSATPNVIEPEINDYDVDVLDDKNVWKPRL
VFENKTKTTTASSVIMKIGPKNTDVELFNIEAAPFQEEESPFPVYYVQSVQPLTHSKKSV
RLTPISGQVIRLRGGPGPNEGYVEVQGILPGWGIVCDSRNSWTLKEANILCRQLGYIRGA
EMAWQGRNNRNGMPNWVAANTVTCFGNETRFQSCKFTHNQECQVARDAIGVRCAPNRIAH
CRKDEIPHNGNCYHLAHPDSGLNHAEALEHCTRRNARLIDIASQAENNFVSELLLQSYPE
VDSIMTSGFGFTTMNRTLWLWADSAHAKFKFTKWWPGWMNDTKQSPWVGYRPRCIVMKRK
FPCYERPESTCDIDYFFWDTEDCAANSKEHFFICKRPYDDIGCTYGKGNQYTGKANVTVS
GNKCLSWADERIAHQLHVNVVNKEVRDKLKMHNYCRNPNPGKESRPWCFTGPGKYEYCDI
PACGNIDPKRSMLSGQCKPKHFECMAGECIPSPWVCDGEEDCTNGADERNCMLDLNLFKK
STKHKLEGYDVEKWLNTPLKTCALRCKEADFTCRSFNHKSNGNVCLLSNSNIGLTGALKP
DKQFDYYEMRERSLDCNDMYICNNNKCINQTQVCDGKNDCNDRSDEDICTAENLDYSIRL
AGADNSYEGRIEVKRVWGQVCDDGFGMINADVICKELGFELGALEVRSSGFYGNLDPPTR
FMVDQLKCRGNETTLRECDFNGWGIHNCQPEEAVGVVCKTAVNTCQEGQWKCDNSPTCIP
TPFICDEVVDCPDRSDESPQHCDAPFELRLANGSSPLQGRVEVRHHGVWGTVCDDDFTNA
TAAVICRSLGYGGIAIAKKDGFFGPGQGLIWLDEVFCHGNESQLYRCEHNHWGQHNCDHN
EDAGVICSPGNVNNAESYWINNPELPERNIDELLPSNCGQRAKDFNNDDDLIFQKVVHGS
IAPKGTYPWQASIRVRGHSRSSHWCGAVMISPIYLLTAAHCLEGYNKGTYFVRAGDYNTD
IDEGTEAEANIEDYYVHEEFRKGHRMNNDIALILLKGHGIPLGKDIMPICLPSENTDYSP
GLNCTISGFGSIETGKTTQSKNLRYGWVPLLDQSVCRASYVYGEGAISEGMMCAGYLDEG
IDTCDGDSGGPLACYHNGAFTLYGITSWGQHCGKANKPGVYVRVAHYRRWIDQKIKESLA
GR
Download sequence
Identical sequences E2A6H3
Cflo_05467--XP_001120871.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]