SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_05733--XP_394163.2_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_05733--XP_394163.2_APIME
Domain Number 1 Region: 1-110,168-472
Classification Level Classification E-value
Superfamily Sema domain 1.86e-122
Family Sema domain 0.00000033
Further Details:      
 
Domain Number 2 Region: 476-515
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000235
Family Plexin repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Cflo_05733--XP_394163.2_APIME
Sequence length 738
Comment [mRNA] [translate_table: standard]
Sequence
MCVVKGTPEENCQNYIRILVKTGSNNLFVCATNAFKPMCRDYTVHAGNYTMMKEKGGQAR
CPYDPQHNSTFVYVDGELYTGTVADFAGMDPIIYREPLQTEQYDSMSLNALCLDDGAVKC
DMGRKAGRKEARKEGNEPAATDRERERKREEHRVRELKENSLAKGLAPNFVNSMSQGDFV
YFFFRETAVEYINCGKCNLPRWRSLHSQAVYSRVARVCKYDRGGPHRFRNRWTSFLKSRL
NCSVTGDFPFYFNEIQSTTELISGQYGGTSAQLIYGTFTTPVNSISGSAVCAFSLQDIAD
TFAGNFKEQSAMNSNWLPVQDTKVPDPRPGQCTNDSRTLPDLTLNFINTHSLMDESVPSF
FGQPIVIRTSFHYRFTQIAVDPQVKTPGGKTYDVLFIGTDNGKVIKAVNAESADSHQKVS
PVVIEEIQAFPQTVPVRGIKVVRASQAGDGLEDGRLVVIADSQVQALRLHRCYSDRILSC
SECVALQDPYCAWDKVEGKCRALVGPASTDANRFLQSVATGTHTSCPPGKSLNKDAGSVG
AISANNNKFPQDSIPNKDNPGGEIINIMQDEEQDNSGPEVSAADTPPPQYSVETLVMAVV
AGALAALFVGFVAGYLCGRKCRKDEDDNLPYPDTEYEYFEQRQNVNRLAPEPKLLPQEEV
TYAEPVLVPQPPKLQSPKGTMRKPPPTPTETLFQFPDGYGFRGGPRGDNFGTLRSHQGDA
YRRTDGFATTRSVKKVYL
Download sequence
Identical sequences E2AQR2
Cflo_05733--XP_394163.2_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]