SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_06161--XP_001121595.1_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Cflo_06161--XP_001121595.1_APIME
Domain Number - Region: 423-483
Classification Level Classification E-value
Superfamily Plexin repeat 0.0061
Family Plexin repeat 0.0065
Further Details:      
 
Domain Number - Region: 47-107
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0732
Family beta-sandwich domain of Sec23/24 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cflo_06161--XP_001121595.1_APIME
Sequence length 592
Comment [mRNA] [translate_table: standard]
Sequence
MDDCCSFDHRSLEIRLINHENVRTRRETPGDKTVVTTDQKDESAKDQPLAQPQQQQPQQQ
QQQASQLATSTTTNSSHDVQYVAYSTSEATVQVKPTDAISTVQASKDANVTSVPKQDINK
KKVASQPVKADDTATLNDWMNRTLASRNISLSNKEQLSSDGKTNQTKEAEIVKDTTSGTE
DVDKHDDIGDISISNISDVTNITLAQNNITKTIYDTHQYYNSTFIVDAEICKKYWVDLDN
HPELRVNHLLSKSHRRAATVKLKFDFPFYGYNVRNITIATGGFLYTGDYVHSWLAATQYI
APLMANFDTRLSNYSYVKYADNGTAFTVEWEKVVLHDHPQSGAFTFQVTLHQNGDIVFVY
SMIPLVIERIEDTMHPVKVGLSDAYIMDRTVFFVRRKTIYEYHRVNFNRQDIMNCTVIYL
KALPTCLNFDNCWDCLTKVPGFDCKWCSDLNKCSTGTSRHRQEWLLKGCDVRNIKEENNC
PAQITTYRGEEYDHDGHVHPEKPITANEISAKQERHDSSPLNNTTPNNMNMGVSGIIGIL
TIIALVAGLAGWGMYAYRNPHSTSGQMLIRYRPSQWSWRRGEARYTAATIHM
Download sequence
Identical sequences E1ZZS4
Cflo_06161--XP_001121595.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]