SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_06303--XP_392426.2_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_06303--XP_392426.2_APIME
Domain Number 1 Region: 64-487
Classification Level Classification E-value
Superfamily Sema domain 3.14e-128
Family Sema domain 0.000000714
Further Details:      
 
Domain Number 2 Region: 538-613
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000612
Family V set domains (antibody variable domain-like) 0.06
Further Details:      
 
Domain Number 3 Region: 489-526
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000575
Family Plexin repeat 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cflo_06303--XP_392426.2_APIME
Sequence length 690
Comment [mRNA] [translate_table: standard]
Sequence
MPEASVRKSTSKVKNLQSLSKHRNCKQRILDEESSLANSASDGVASTTLIIADYETVLLS
DERDALNLEPSNVAQCVSKGKSEHFDCRNHIRVIQPMGDGNRLYICGTNAHAPKDWVIYS
NLTHLPRHEYVPGVGMGIAKCPYDPADNSTAVWVEKGNPGDLPALYSGTNAEFTKADTVI
FRTDLYNLTTGRKAFSFKRTLKYDSKWLDKPNFVGAYDIGSHVFFFFRETAVEYINCGKS
VYSRVARVCKRDTGGKNILAQNWATYLKARLNCSIPGEFPFYFNEIQSIYKVPGDDTHFY
GTFTTSTNGLMGSAICSFHINAIQEAFRGKFKEQASSSSAWLPVLSNKVPEPRPGQCVND
TETLPDTVLNFIRSHPLMDSAISHENEKPVFYKRDVMLTRLVVDKLRIDFVGIDLDYTVY
YAGSSDGRVHKVVQWIDSNGESQSILLDVFDVTPGEPIQAMEISKEHKALYVASDHRIKQ
IDLVMCTRRYDNCLRCVHDPYCGWDKDTNTCKPYEPGLLQDVSNSTADVCDSSVGKRKLV
VTWGQSVHLGCFVKMPEVLANQEVRWYHYSKEKGRYQIAYKYGAGGDKFIETSEKGLVIV
GVNEQDAGRYDCWLGGALLCSYNITVDAHRCSAPAKSNDYQKIYSDWCHEFEKYKSAMKS
WERKQAQCASRQNDSNQNVHTNEVYGTPLV
Download sequence
Identical sequences E2A5X9
Cflo_06303--XP_392426.2_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]