SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_06577--XP_393523.3_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_06577--XP_393523.3_APIME
Domain Number 1 Region: 1110-1183
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000994
Family Tachycitin 0.02
Further Details:      
 
Domain Number 2 Region: 707-768
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000154
Family Tachycitin 0.096
Further Details:      
 
Domain Number 3 Region: 928-987
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000209
Family Tachycitin 0.037
Further Details:      
 
Domain Number 4 Region: 182-244
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000022
Family Antifungal peptide scarabaecin 0.061
Further Details:      
 
Domain Number 5 Region: 1390-1446
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000262
Family Antifungal peptide scarabaecin 0.079
Further Details:      
 
Domain Number 6 Region: 40-92
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000183
Family Tachycitin 0.035
Further Details:      
 
Weak hits

Sequence:  Cflo_06577--XP_393523.3_APIME
Domain Number - Region: 1473-1532
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00288
Family Tachycitin 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cflo_06577--XP_393523.3_APIME
Sequence length 1562
Comment [mRNA] [translate_table: standard]
Sequence
MWKTSMIPSILATLIITRLTKANYYEYNQNQYKQSITPFKCTEEGYHADPHDCRVYYRCV
DWGNGSPLTVFKFECGVGTVFSKNKGDICTHPGDSGRLECAGSENELDSNLHNPPESPSP
IWTTTVRITTRPQQTATQSPVTTRQPAITTQAATTIRKPETTQSPLTSRPTTDQLENNCK
NELQCTQEEFLADTCDCRKFYRCVDDGYGKFKKYNFTCGSGTVWDPEIQGCNHAWAVTKG
NCKQSLESNVNSPSSPGYPGYPGSSGSAGSPGSPGSPGSPGLPGSSGSPGYPGYPGSPGS
PGSPGSPGYPGSPGSPGSPGSPGSPGSPGSPGSPGYPGYPGYPGYPGSPVTPDTPGSAGS
PGSSGSPGSPGSPGYPGYPGSPGSPDTPGSAGSPGSSGSPGSPGSPGSPGSPGSPGSPGS
PGSPGSPGYPGYPGSPGTSGSSGSPGSPGSPASPGSPGSPGYPGYPGYPGYPGYPGSPGS
PGSSGSSGYPNSSGYPGSPDTPGSPGSPGSAGSPGYPGSVGSPGSPGSPGSPGSPGSPGS
PGSPGSSGSPGSPVSPGSPDSPGYPGSPGTPDSHGSPGSPGYPGYPGSPGSPGSSGSPGY
PHSPGYPGSPGTAGSPGSPGSPGSPGSPGSPGSPGSPGSAGSPGSPGSPGSPGSPGSPGS
PGSPGSPDSPGIPGSSSFPNNSSSSNYPEAPCSPGTSEALDSPGHESSTDRCTREGFFVY
PNDCRKFYRCVNDGTSFTKYEFECGVGTVWDSSIQSCNHIYAVPHCNYTSDIITNRPDTS
LNEVDSTDKPDTSKSPPVQSPESSTIPSISSKPEISSSTQEAESITSKPDVPPQTTSVSY
LPPISSTYPSSTMQVNESVSYLPPVTQTTTSISYLPPSSTATTNAMSGSTAESISYLPPD
TSASTDTTPITSTLPSSTSSTTSSTQPGKYECTEEGFFSNSSNCKKFYRCVKYQSGYQKY
EFECAAGTAWDQSIQTCNYIEQVASCLMENNEIDQSAISSASPTSGSLVTSSSTTIASSQ
ITAITSSSAIPTTITSTPETSTETSTLEEDKTEASSTTIVSAASEKPEEIQTPASSSTEN
LPESSSEQPSSESSQESSSSTESHVSDCTTQKLNNTIVCNNEGFYPHPIRCDKFYRCVDN
GNGFNVYHFDCPPGTIFDPSISVCNYPESVYPARDCTTGNIPSSTVESTTESETSEQSVS
TIITTTSTTTQQTEESTIISSTTTSETTTQTQQTEESTITSSIESTTTEISESTENMTES
TTESITTVAESVTDSSTERTEAPASTESTESEKPTTESQESTTESQEQSTESQEQSTTES
QEQSTTESQEQSTTESQEQSTTESQEQSTTESQEQSTTELSEPTTSSAEPAAATPCAIGN
LTDEQILLVCPTGFRRHPNHCNLFYQCTSEGSMEIKILVLSCPENTIFDEKKIQCLPADQ
SSDPCTGTKANIRLNRRVENDALSPVKVSSNRLCPEEGHFPYRQGCSNNFYKCKRDIRNN
LQGYLYKCPENFVYWSVSRRCERATRLPMCSHLTYRNKIDWNDRWQIPIEDFNLSARMLR
FS
Download sequence
Identical sequences E2AWV6
Cflo_06577--XP_393523.3_APIME XP_019884832.1.72520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]