SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_07450--XP_393988.3_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_07450--XP_393988.3_APIME
Domain Number 1 Region: 2837-2901
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000149
Family Tachycitin 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cflo_07450--XP_393988.3_APIME
Sequence length 3385
Comment [mRNA] [translate_table: standard]
Sequence
MGFTTERITTQRVSPEEYSESKEDDQSDEITIPKIPPDNQSNSEENDNKNDNQSDKNKKK
DKHSREDSGSNEKHTKKPKKENDASKEIEITTQQITTQHILPEDYSGSKEDDQSDEITIP
KIPPDNQSNSEENDNKNDNQSDDNINDNQSDKNKKKDKHSHEDSSSNEKHTKKPKKEKDA
SKEMGFTTERITTQRVSPEEYSESKEDDQSDEITIPKIPPGNQSNSEEHSNENDNQSDKN
EKKDKHSHEDSSSNEKHTKKPKKEKDASKEIEITTQKITTQRVSPEEYSGSKEDDQSDEI
TIPKIPPDNQSNSEENDNKNDNQSDDNINDNQSDKNKKKDKHSREDSGSNEKHTKKPKKE
NDASKEIEITTQQITTQHILPEDYSGSKEDDQSDEITIPKIPPGNQSNSEEHSNENDNQS
DKNKKKDKHNHEDSSSNEKHTKKPKKEKDASKEMGFTTERITTQRVSPEEYSESKEDDQS
DEITIPKIPPGNQSNSEEHSNENDNQSDKNEKKDKHSHEDSNSNEKHTKKPKKEKDASKE
MGFTTERITTQRVSPEEYSESKEDDQSDEITIPKIPPGNQSNSEEHSNENDNQSDKNEKK
DKHSHEDSSSNEKHTKKPKKENDASKEIEITTQQITTQHILPEDYSGSKEDDQSDEITIP
KIPPGNQSNSEEHSNENDNQSDKNEKKDKHSHEDSSSNEKHTKKPKKEKDASKEMGFTTE
RITTQRVSPEEYSESKEDDQSDEITIPKIPPGNQSNSEEHSNENDNQSDKNKKKDKHNHE
DSSSNEKHTKKPKKEKDASKEMGFTTERITTQRVSPEEYSESKEDDQSDEITIPKIPPGN
QSNSEEHSNENDNQSDKNEKKDKHSHEDSNSNEKHTKKPKKENDASKEIEITTQQITTQH
ILPEDYSGSKEDDQSDEITIPKIPPGNQSNSEEHSNENDNQSDKNEKKDKHSHEDSSSNE
KHTKKPKKEKDASKEMGFTTERITTQRVSPEEYSESKEDDQSDEITIPKIPPGNQSNSEE
HSNENDNQSDKNEKKDKHSHEDSSSNEKHTKKPKKEKDASKEMGFTTERITTQRVSPEEY
SESKEDDQSDEITIPKIPPGNQSNSEEHSNENDNQSDKNKKKDKHNHEDSSSNEKHTKKP
KKENDASKEIEITTQQITTQHILPEDYSGSKEDDQSDEITIPKIPPGNQSNSEEHSNEND
NQSDKNEKKDKHSHEDSNSNEKHTKKPKKEKDASKEMGFTTERITTQRVSPEEYSESKED
DQSDEITIPKIPPGNQSNSEEHSNENDNQSDKNEKKDKHSHEDSSSNEKHTKKPKKEKDA
SKEMGFTTERITTQRVSPEEYSESKEDDQSDEITIPKIPPGNQSNSEEHSNENDNQSDKN
EKKDKHSHEDSSSNEKHTKKPKKENDASKEIEITTQQITTQHILPEDYSGSKEDDQSDEI
TIPKIPPGNQSNSEEHSNENDNQSDKNKKKDKHNHEDSSSNEKHTKKPKKEKDASKEMGF
TTERITTQRVSPEEYSESKEDDQSDEITIPKIPPGNQSNSEEHSNENDNQSDKNEKKDKH
SHEDSNSNEKHTKKPKKEKDASKEMGFTTERITTQRVSPEEYSESKEDDQSDEITIPKIP
PGNQSNSEEHSNENDNQSDKNEKKDKHSHEDSSSNEKHTKKPKKENDASKEIEITTQQIT
TQHILPEDYSGSKEDDQSDEITIPKIPPGNQSNSEEHSNENDNQSDKNEKKDKHSHEDSS
SNEKHTKKPKKEKDASKEMGFTTERITTQRVSPEEYSESKEDDQSDEITIPKIPPGNQSN
SEEHSNENDNQSDKNKKKDKHNHEDSSSNEKHTKKPKKEKDASKEMGFTTERITTQRVSP
EEYSESKEDDQSDEITIPKIPPGNQSNSEEHSNENDNQSDKNEKKDKHSHEDSSSNEKHT
KKPKKENDASKEIEITTQQITTQHILPEDYSGSKEDDQSDEITIPKIPPDNQSNSEENDN
KNDNQSDDNIDNQSDKNEKKDKHSHEDSNSNEKHTKKPKKEKDASKEIEITTQKITTQRV
SPEEYSGSKEDDQSDEITIPKIPPGNQSNSKENSNKNDKQSDKKENKGKHSHEDSSSNEK
HTKHPKKEKDTSKEIGLTTERFTTQLVSLEEYSGSKEDDQSDEITIPKIPTENQSNSKEN
GRNDDSSERKISSPQFPIEHQSESKEDKNKNSDEDKITTSQIPTKDVSASNENNKNNDGS
ENKLTTSHIQTENFSGSKEKSENNGENEFTTPQSSTENQFTNNEDNENNKSSENKMNITE
IPTENQSERKENSENNENSGNKITTPYIPTKNLSGSKEDNKNSNSGENKITTPPIKSESN
EDNKNNKSNENKITTPQIPTKDEFESSENSKTNICGNKITTPYSSTEKLSESKEDNKNSN
DGENKTTTSQIPTENQSGSKEDNENNKSSENKVITPKLSTENQSESKEDKNRISDENKIT
TPQISTKDESASNENSKNNDGSENMITVPHISTENLPEDKKDNKNSDSNENKITTLRIPT
EKQSERNEDNENNQSNENKTSTPQLSTENLSGSEGNGKNSDSNENKITTPEFPTKNLSES
KEDKSRDNDENKITTPQIPTKDESGNNESSKNNDCSGNKITTSHILTENLPESKEDSKNI
DNDKNKIIIPQITTESQSGSKGDNENNKDENKITTPHFSTKDESGSKETNPHVATENHSG
SEKDNENISGGNKITTPQISIENQSGSKENNENNKNNENKITTPQFPTENQSGSKEDNKN
KNDDENKITTPQIPIKDKSENNEKTNNNCNGNKITTPQISTEYQSASKDSQNNENSESAI
STTQIPSENDPEIEKRPNEFVSDCVSPGFFPNLNDCTKYYRCVEVESKALKKIDFDCPRG
TVWDQDNTICNFPSAVKHLSCKNNESSSKTVVLFKREINDNGESNDNEKQTITNFSTATE
PPTESTISTELPYPIGNLIGDQMDLVCPTGFQRHPRYCNLFYQYNIVQTTCGGKSSKNET
LTPIKQNLPKIIANCVLPKGIKILKGVRIEKLRINNSLQSNIPTQISLEQDVKTRCNNDK
SIAQTFCNDTTEIITTIENIREKKHHTSHEINESFDTLKISSPLNSNVDLKDNNNVDLKD
KDLSNNKSHSKLIDYRNLNSATKVKNNGDISINNIGEIIMTHENYTLSNQEQLNRFTNNT
EIHENNILQDNRKCEEKCTKNILNKNVSDLMDIDDENYISTSSILASKEGNILLKKPLKR
TLKEKDCNQSSKKMKLNRNSWLQSVAFKSSNYQQDNDSLSSVTTNTTVETNKTKKYNQEE
RPDLRKFLNQMKSEKSFKLKPTVEIANEEVCKKLSVKEESTLNGTLYEKKSDAQENPSSS
VASDDEDDDCISLFAEPFAEFDTSQ
Download sequence
Identical sequences E2A1A5
Cflo_07450--XP_393988.3_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]