SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_07524--XP_393252.3_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_07524--XP_393252.3_APIME
Domain Number 1 Region: 45-300,373-417
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.9e-95
Family Type II chitinase 0.000000355
Further Details:      
 
Domain Number 2 Region: 296-368
Classification Level Classification E-value
Superfamily Chitinase insertion domain 6.41e-18
Family Chitinase insertion domain 0.0004
Further Details:      
 
Domain Number 3 Region: 566-639
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000115
Family Tachycitin 0.019
Further Details:      
 
Domain Number 4 Region: 4050-4105
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000968
Family Tachycitin 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cflo_07524--XP_393252.3_APIME
Sequence length 4106
Comment [mRNA] [translate_table: standard]
Sequence
MVVFSITLDVQKSGSGNIRRVIPWKGQPGCRLHYYSDSPGIAERKIVCYYTNWSVYRPGT
AKFSPQNINPYLCTHLIYAFGGFTKDNALKPFDKYQDIEKGGYAKFTGLKTYNKNLKTML
AIGGWNEGSSRFSPMVADSERRREFVKNAVKFLRQNHFDGLDLDWEYPAFRDGGKPRDKD
NYANLVQELYEEFERESSKTGRPRLLLSMAMPAGIEYIDKGYDVPRLNEYLDFVNLLSYD
YHSAYEPAVNHHSPLYPLEEDNEYNYDAELTIDYTISHLLGKGASADKIILGIPTYGRSY
TLFNQEATELGSPADGPGIEGEATREKGYLAYYEICENVAESDEWEVVQPNPKAMGPYAF
NGNQWVGYDDEDIVKLKARYVNEKKLGGIMFWSVDNDDFRGKCHGRPYPLIEAAKEALLT
DNSRNTIENTKSVESRKKIRTQGIQSNVRKYSQRSSTTSAPITSRRASSSRLKYRNISKS
KTNDEDEEDRDVARRSYDPSPDEEIEGRNSVRVTEKTERPKNRHRSKTRSSDHTSRRKQS
RRKEQSKTDENEESLSNKLTTPEPPTTPDPGTDFKCEDEGFFPHPRDCKKYFWCLDSGPS
GLGVVAHQFTCPSGLVFNKAADSCDYPRNVICPKTSKTSVVSTTKSPITAATSRTTYLHS
TTTAKAESEEYDSEEEDYEEDDIEETEEEEVKEEPKITTTMKPLVYKTLTRRPSTTTTTR
TTKPSEPERASDGEDEEDPRVIKELIDLIRKAGGIEQLEKQLLFQEKNSGLKSDTANVTP
TTISRSLYERVLNRQTTNKLSNKPVLSSSETSYVNGPGRAQFEGLDDIPEVKNLRRSQKP
QYVTIERSKSSVTKDTDNEDEEAEDNTDVASTEEDSVSNPLESSSSTQRVTPSYVNIRRT
RPSTTTSKTENDVEEKEEEVDEEKPTRRRRPYVSKNSKKESDSVDVDLSTEKNDASSTIN
SRYTNVQRFRGIASKNSENLSSVSPLEITTLPTKLEEYSEVPSSTTDSTTTSASTTSTTG
VSTSTEIVTVISVEPPENPSSVSPKIDNTSSNTSSTKLEEDSVTEILITTLPEITSSTTK
TTTASAGRSTIAAVSQPRPFGFTRRRFSSSEATTTTSAPLNRSKVSISSRNSTRPASPFL
ARARSRTRPTNRVVEDESTEHVDASQVETSTFKSKDSSRSRNRGPSRYTSPTSRSRTSKD
VSTNSVPSPRYRGRGRTTISTTVSTIADTDTRRKYRRPSRLSSTESIIIIFSLFTLFLKS
FRYTNVQRFRGIASKNSENLSSVSPLEITTLPTKLEEYSEVPSSTTDSTTTSASTTSTTG
VSTSTEIVTVISVEPPENPSSVSPKIDNTSSNTSSTKLEEDSVTEILITTLPEITSSTTK
TTTASAGRSTIAAVSQPRPFGFTRRRFSSSEATTTTSAPLNRSKVSISSRNSTRPASPFL
ARARSRTRPTNRVVEDESTEHVDASQVETSTFKSKDSSRSRNRGPSRYTSPTSRSRTSKD
VSTNSVPSPRYRGRGRTTISTTVSTIADTDTRRKYRRPSRLSSTESIKANELDDSPIVRI
NQGNRKRNSSLRSRFENNDEESDKVTNIRVFKRPTVNRELYDRTKQKKRNNVQKVNVESK
QIASITPQILESSTSTEGDNIEKNDLINIVDQEATIVDSVVESNTIEPKYDHVKPVTLID
ITTTSNNKVDYTSDQPDDAIATTITHIETHEFNPNLVIIVSEHGSTSEAPKRRKIILKRR
PISSNNTIEAEEEQKSETFRRRKVIKRKRPLQDTSSPTSTVSLEQEVLENSSPVPESTTS
IGDTKDVEKSTVTTDQTEITLMNKDAEELPVATGYTREMQDSTLAITETTLSTDYNLDDF
AKIILETPAEEISTIWNKETTDSFNNAAISTVNTYTDEEYQSTSEMNFEASTIESTLATA
TIDNTESTAPLEETLVPELENLSTQIVTTLSTSEPDSTRAQITTRLFTTELDSSSVSKPT
FDPRYTRKKFIRKSPVSSGTNTTNQYPPVLSSTENANFEIRSRRRNNLFIRRPVSSTTAN
TPSDDLKYQEEKEKQSANNRSRDSIEEEVAEDTILKNKSVSADALSANFAEFWKTYTTAS
SINQISNSSTHNEDIDERGKIAETEDTSQSILTTTNKSEIRPRYKIPVILKRPFDPEEAL
SPKRYPLDSAPEESEETKETKPRQASFRQPRTRYKLQNRDNFKTEESTSNPEPTSTWQYI
RTRSYLKRPSSTSTEATVTETLIPARKFDYAADAFHRKQQSLRTTTPRSNYPFDSQNLVD
PDYTSLTTAKPSVTRLITSVTESGTTERQKILIKTKYSSLTSTTRIPADQFSSTIPSIAG
TGLDDESVNEIRQGVERSTLPIEGEFNHHYDRFTTESQEPSTIEIESVADSKTIRLPTLK
ELIGYPTTYYYDRIATTPSSALLHLLRNDVDNDISQQNVEKISFQGTNESQSGEREESAR
DIIGEETGDWWLQNKARSRISKKIDITLEEAQNTSTPVIQEDEDGRRESSTSMYLRPTTM
RGIPPVSLTSTPRIRGFYITKSEDDLPSSTLTVDFTSPYTTIDSSIEQQTEIASTPGISA
TEETVSFIHNNQNKSEINDNMNDVVTDEVVTRNELELDAFNANVSDIIKSKGDKHEENSS
TFGPLVTFSENSDSVENSSIYTEPTVTIPINKSVENKRETSLRNFGYNSSSLSDVYAIGP
TTSTRRKIAIALNRYNKASTPLWTGKRIVPKKRNRTAILSKSIKEAERRVDETTFPLITT
DTFKNASATSEIPSTLISTNNKLDAISTVPTTLIASESTTSAEMLDVYRDIAYSTDSTDD
LQTEDPNDRTNAEATITLLTNINSVIATTPSISEITSITNDSTVISTISDDSTSVTTMAS
ANESIIVVTPSSIVAKTPVVANDQATITTKSMIKSTAIEIPVSTTANYSVAAVPTIASTQ
AIANDSAITPATTTIGVEITSPIANCSTDFANMIIPATINAEVEATSAITNYSVTAIPIN
TSTNAIVTDSAVTTAPAITINTEIETSTVADPAVTISTAINTQEIDPTTITTSATTGTEA
ETTITNLHVFVNTATTMIPTTSTLPSTIISSTDNRDVTEPATSNIPDVDTITMTDMSTTT
TPTTVVTSTISDLNLITSANANDPSTFAVTDTSTIPSLPITNSVILSKDSVTSADEASAS
STVPTTLIESTTAHFNSNVFNISNTSEVSAITATAKSVQTTEIPTTFETSPIFTSISRSL
SSTNSATLSTTAFSETSENFVASMVTQNPSTLFSTITPVTNIAVENATLSAIYDSIATNT
IIQTTGVYKSNSVQTTSEKPTTPKIKITSEETASKTIQNREDKTSKLNDQLGQKSVRRRV
INRTNNWIGRPVVQQTINQYPPHRATVYRERLQRPPGYTSRVIEENRRRRIVQRRMRVNF
EPISSTTRPDENVMVVQNITENYVQNITENHVPYHRARNTRKRMKIVSKRVRERPEEKEI
TTLRETTSLSQATVTDNKTEATQHEKVHHENGNVERKWKFLLRRIKPQSQENLAADETSA
NFNSVNESLTSNFQNNFRMSKNLSEQKNRRGRTRVVLKSIRPKSEERSPIEGARGNPDLK
KFQGNFPTNFHANKNSSEKGRRMKVLLKRVRPKSKENNSTIEETNGNENLQNNLSTRENF
PDEKKIRRGMRVVLKRVRPKFEEEKVKIKEANADVDSTNANLQGALLNFRGGRNFPIEYN
TRRTTRVVLRNVKPKFEENNSTIKKTDSDSTNKDLQSSFSNNFYTNVDLSDEEETRKFKS
EEKDSIAEETSAHFDFTDKNVSSNFSNREKIATYFKHGKKEATVERLEDIEEQQTTETFV
LAEQDTDQPSLEINSSKNGGSVNRKLGHAIRHRKPSTTPAPLINSFPSTVAIYRNGRPIE
TTFSSRVDLVDAFEDTRSTVMQDDQKPDVSDQSIRAQEFAVTLADPPLSSSSDTGRTVLR
DAARRKISTTVAPRTDPNTIDRTISRYDADFRNRQRPKTQSTRPIVNTTTRPRRPSVLDY
DYYEDDVPIVSGKSFLNSKLFLTSKGTIRCLDQGNFPHPYSCKKFITCTRMLNGQIIGTE
YTCPDKLTFDPVGGICNWSAGLGCNN
Download sequence
Identical sequences E2ACU7
Cflo_07524--XP_393252.3_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]