SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_08421--XP_001122292.1_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_08421--XP_001122292.1_APIME
Domain Number 1 Region: 691-744
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000034
Family Tachycitin 0.0039
Further Details:      
 
Domain Number 2 Region: 998-1046
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000471
Family Tachycitin 0.0075
Further Details:      
 
Domain Number 3 Region: 935-987
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000112
Family Tachycitin 0.0094
Further Details:      
 
Domain Number 4 Region: 627-677
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000262
Family Tachycitin 0.007
Further Details:      
 
Domain Number 5 Region: 815-877
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000011
Family Tachycitin 0.0085
Further Details:      
 
Domain Number 6 Region: 1065-1120
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000497
Family Tachycitin 0.0085
Further Details:      
 
Domain Number 7 Region: 760-814
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000139
Family Tachycitin 0.011
Further Details:      
 
Domain Number 8 Region: 38-100
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000118
Family Tachycitin 0.0029
Further Details:      
 
Domain Number 9 Region: 1161-1211
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000471
Family Tachycitin 0.022
Further Details:      
 
Domain Number 10 Region: 1280-1330
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000471
Family Tachycitin 0.022
Further Details:      
 
Domain Number 11 Region: 1400-1450
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000471
Family Tachycitin 0.022
Further Details:      
 
Domain Number 12 Region: 1530-1581
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000497
Family Tachycitin 0.017
Further Details:      
 
Domain Number 13 Region: 1651-1700
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000654
Family Tachycitin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cflo_08421--XP_001122292.1_APIME
Sequence length 1704
Comment [mRNA] [translate_table: standard]
Sequence
MKEIYLVAILYVATLSVALNISSVTDFPTECPAESQDKIIYLPYENDCTKFYSCYMGIKG
EPQDCPFRDNKGNRLHFNPVLQVCDWPRSAGCKLSKPTSASITPKSPPTSSSSSSSSPPT
VSSNSPISPTSSSNPPTTTSSSSSSTLPTSSSSSLPTTTSSSSPTSSSLPSTISSDSPTS
PTSNPFPSATPASSSPIFQSSSSLPPKTTLSSSSTSSISSSTSSPETTTSNSPTSLTSPT
TPSSPTSSSSLPPKTTLSSSSTSSISSSTSSPETTTSNSPTSLTSPTTPSSPTSSSLPST
ISSDSPTSPTSNPFPSTTSASSSPILPSSSSLPPTTTLSSSSTSSTSSSTSSPETTTSSS
PTSLTSPITPSSPTSSSSLPPTTTLSSSSTSSTSSSTSSPETTTSNSPTSLTSPTTPSSP
TSSSNPSTTTTSSSSPTSSSPPLTTSSDSSTSPTSSSSPFPPTTLSSNSPASSTSPSSSP
LTSSSSTPILPSSSSFPSITTSSSSSLTSSSSSPIPTTTSSSPTSLTSNSPTTPSSSTLS
TSSSNPSTTTTSSSSPALPSSSPSTISSSSSPILPTSSSSLFPTMPSLPSSSISSTSTTI
STAISATTTEISEKPRMQCPSESSTETVRIAHQCLCNVYYECINGDKIRQTCPIGMHFDY
EREVCDWPEAANCVHSISTQNFLIDRYENKCYQEGKAFQHEIDCSSYYLCVEGNKILKHC
MAGLHFNVTLQMCDYPTKASCDFIVTFLPAANPASCSSSNSTEKVLLPHECNCAQYYECI
NGNLLLQDCPNGLDFDRIRNTCSQPNDAKCPYVCPCASSTKKVLLPHECNCGQYYECVRG
QPALRNCPNNLHFDYIEKICKSSNEATCATSTKPTTTSTDSTVTDTSITGSTETDARITG
PTVTDTSITGSTVTPTGGPETPRQKCPPKGSTEKARIAHPWVCYLYYECVNGNKEERMCP
IGKHFDYIQEVCDWPWKVNCMRPIPTHDMSIDDCHNKCSPEGRTFRHETDCSLYYLCSNG
KKILQQCTAGLHFNITLQICNYPYKSCDLPDNTYSTITQNVCPSNSTEKIRFPHNCKCTY
YHECVNGKKILHKCPEGLHFDIVQKTCNDPYKSGCAPTFPKSTPMPIISTTKWSKEPDKT
TTENPLDPSKCIGTCPEIDPPKAVLLPNEDCKKFCMCSNGIAWVQPCPEPLYFDSKDTVC
KNKRDAVCGKRLFNQDRVSMHHRMFNENSLQSPKKENNDDQGIHDNSLSKHIYNFDDKTT
TENPLDPSKCIGTCPEIDPPKAVLLPNEDCKKFCMCSNGIAWVQPCPEPLYFDSKDTVCK
NKRDAVCGKRLFNQDRVSMHYRMFDEKNSLQSLNKENNDDHGIHDNSLSKHIYNFDDKTT
TENPLDPSKCIGTCPEIDPPKAVLLPNEDCKKFCMCSNGIAWVQPCPEPLYFDSKDTVCK
NKRDAVCGKRLFNQDRVSMHYRMFDEKNSLQSLNKENNDDHGIHDNSLSKHIYNFDDKTT
TDKTTTENPLDPSKCIDPSKCIGTCPEIDPPKAVLLPNEDCKKFCMCSNGIAWVQPCPEP
LYFDSKDKVCKNKRDAVCGKRLFNQDRVSMYHRIFDEKNSLQTLKKENNDDQGIHDNFLS
KHIYNFDDKTTTENPLDPSKCIGTCPEIDPPKAVLLPNEDCKKFCMCSNGIAWVQPCPEP
LYFDSKDTVCKNKRDAVCGKRSFN
Download sequence
Identical sequences E2ADF6
Cflo_08421--XP_001122292.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]