SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_09000--XP_393551.2_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_09000--XP_393551.2_APIME
Domain Number 1 Region: 23-87
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000314
Family Tachycitin 0.022
Further Details:      
 
Domain Number 2 Region: 92-154
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000199
Family Tachycitin 0.026
Further Details:      
 
Domain Number 3 Region: 163-218
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000254
Family Antifungal peptide scarabaecin 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Cflo_09000--XP_393551.2_APIME
Sequence length 231
Comment [mRNA] [translate_table: standard]
Sequence
MEKRVLFRHFLPFLTLVALSWAQFRCPEPKGFFADPEQCDLYYSCVDNQPEEKLCKDGLV
FRDDNPKKELCDIPANVPCGDRTLLHTPIGSPGCEYQFGMYPGSDSCSTSYIKCIYGEPH
QAHCDPGLVYNAKTHTCVWPDELIPFCNPEAIVGFKCPHKLPPNSPAAKFWPYPRFPVPG
DCGRLITCVDGHPRLLTCGDGKLFDSVSLTCLDPDDVPHWFVHFAFLKTRS
Download sequence
Identical sequences E2A163
Cflo_09000--XP_393551.2_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]