SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_09001--XP_001120217.1_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_09001--XP_001120217.1_APIME
Domain Number 1 Region: 83-145
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000445
Family Tachycitin 0.0065
Further Details:      
 
Domain Number 2 Region: 175-224
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000102
Family Tachycitin 0.023
Further Details:      
 
Domain Number 3 Region: 19-84
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000034
Family Tachycitin 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cflo_09001--XP_001120217.1_APIME
Sequence length 243
Comment [mRNA] [translate_table: standard]
Sequence
MFAAGIVTLLGAIALTHAAFNCPSKDGQYEDSKQCDKYYDCIDGIASEKLCPDGLVFDPL
NRKVNKCDHVFNVDCGDRLELQPPQPTKKCPRRNGFFAHPDPSVCNIFYNCIDGEAIEIT
CTTGLHFDEYSGTCVWPDSAGREGCGVLGKKLQDGFECPSEGQVDSRGMLIDHPKFPHPD
DCQKFYVCLNGVTPREQGCSDGTVYNEEQQRCDAPENVPGWLEEFNNCFLCSEDWYKDDD
KKL
Download sequence
Identical sequences E2A164
Cflo_09001--XP_001120217.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]