SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_09683--XP_001119969.1_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_09683--XP_001119969.1_APIME
Domain Number 1 Region: 18-72
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 2.88e-16
Family Tachycitin 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cflo_09683--XP_001119969.1_APIME
Sequence length 75
Comment [mRNA] [translate_table: standard]
Sequence
MFYTQAQEIECPNRPPREGENAILIPDPTNCKHYFVCDYGRTILMECPGDMHFNPIEKVC
DFSWKAGCTANEPYK
Download sequence
Identical sequences E2AEZ0
Cflo_09683--XP_001119969.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]