SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_10081--XP_396925.3_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_10081--XP_396925.3_APIME
Domain Number 1 Region: 57-304,374-426
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.73e-99
Family Type II chitinase 0.0000000885
Further Details:      
 
Domain Number 2 Region: 490-729,800-850
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.15e-97
Family Type II chitinase 0.000000227
Further Details:      
 
Domain Number 3 Region: 304-373
Classification Level Classification E-value
Superfamily Chitinase insertion domain 3.27e-24
Family Chitinase insertion domain 0.00026
Further Details:      
 
Domain Number 4 Region: 729-799
Classification Level Classification E-value
Superfamily Chitinase insertion domain 4.06e-23
Family Chitinase insertion domain 0.00015
Further Details:      
 
Domain Number 5 Region: 874-940
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000314
Family Tachycitin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cflo_10081--XP_396925.3_APIME
Sequence length 944
Comment [mRNA] [translate_table: standard]
Sequence
MYSPGARKRFRRPTTSAPSISNDQEVSASVNRFKVTRNRVSNKNTKNELQPDKTDDYKLV
CYYTNWSQYRTKIGKFMPEDIQPDLCTHVVFAFGWLKKNKLTSFESNDETKDGKIGLYER
VVNLKKANPSLKILLAIGGWSFGTQKFKDVSSTRYARQTFIYSAIPYLRDRNFDGLDIDW
EYPKGGDDKKNYVLLLKELREAFEAEAQERKKQRLLLTAAVPVGPDNVKSGYDVPAVASY
LDFINLMAYDFHGKWERETGHNAPLYASSLDSEWQKQLSVDNAAAMWVKLGAPKEKLIIG
MPTYGRSFTLANPANFRVHSTASGGGKAGEYTKESGFLAYYEICEMLHNGAAYVWDDEMK
VPYLVHNDQWVGFDDEKSIRNKMHWLKSKGYGGAMVWTVDMDDFNGTVCGGNVRYPLIGA
MREELRGISRGSNAKDIDWSAVATTITETIVKKPEAYKISVSEVLNKPKKLQKSTTLVIN
TPTHEREAQTICYLTNWSHKRPGMGRFNPEDIDPTLCSHVVYAFATLKDHLLTEGSDKDA
EMYQRLIALRDKNPDIKILLAIGGWAFGSTPFKELTSNTFRMNQFVYEAIDFLREYKFDG
LDVDWEYPRGADDRSAYVNLLKELRLAFEGEAKSSGQPKLILSAAVPASFEAIAAGYDVP
EISKYLDFINVMAYDFHGQWERQVGHNSPLYPLESATSYQKKLTVDYSAREWVKQGAPKE
KLMIGMPTYGRSFTLVDKDKFDIGAPASGGGLAGNFTNESGFLSYYEVCSFLNEDNTTLV
WDSEQQVPFAYRDDQWVGFDDERSLINKMAWLKEEGFGGVMIWSVDMDDFRGSCGAGRYP
LIKAMKKELQDYKVKLEYDGPYESTSRNGKYTTKDPNETICDEEDNHISYHADKNDCTMY
YMCEGERKHHMPCPVNLVFNPNENVCDWPENVEGCLQHTQAPPV
Download sequence
Identical sequences E2AH26
Cflo_10081--XP_396925.3_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]