SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_10282--XP_397120.3_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_10282--XP_397120.3_APIME
Domain Number 1 Region: 117-183
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000314
Family Tachycitin 0.011
Further Details:      
 
Domain Number 2 Region: 198-254
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000034
Family Tachycitin 0.016
Further Details:      
 
Domain Number 3 Region: 54-111
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000811
Family Tachycitin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cflo_10282--XP_397120.3_APIME
Sequence length 263
Comment [mRNA] [translate_table: standard]
Sequence
MASRPIVHLLIACGIFVVTTSLNQNPRFSNQLFNNQLNRNQQQFSQKGGLSASCPERNGR
YPVPNQCDAYIECIDGVAEEKLCPEGLYFNPEARFNYPCGYPIDVDCTGRPNLQKASPTE
DCPHQYGYFKIGNHQNCGQFMNCVDGRGYVFDCPEGLAFNPESYRCDWPDQVSDCDAEAF
LGFRCPEVKNSPFLDAEIKFYRSTVDCHHYYICVNGRPRLQNCGTGNAFNELIDACDAAE
NVTGCEHEAIAKTTPTYGQAKLF
Download sequence
Identical sequences E2AYK3
XP_011266299.1.72520 Cflo_10282--XP_397120.3_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]