SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_11501--XP_396806.2_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_11501--XP_396806.2_APIME
Domain Number 1 Region: 400-593
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.4e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0042
Further Details:      
 
Domain Number 2 Region: 571-692
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.02e-26
Family Ypt/Rab-GAP domain of gyp1p 0.004
Further Details:      
 
Weak hits

Sequence:  Cflo_11501--XP_396806.2_APIME
Domain Number - Region: 149-169
Classification Level Classification E-value
Superfamily Plexin repeat 0.0785
Family Plexin repeat 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cflo_11501--XP_396806.2_APIME
Sequence length 739
Comment [mRNA] [translate_table: standard]
Sequence
MPLPNILRKASSFILGDCGQDNRRVIYQDGEALFCKNNVCVHPPTLMRQNTDVVHHPGYM
TVTCKLNKNSNLPTLHLSWIPNSTLRKHPTALENLSARNAAAHHHRDDDPTVPRSQIPKA
RGADERHVLENENEHENDVENDNGNGKLDVCLEAKEPVSCGDCERVCSGSGYDFSRRNIG
DEFEKNSGERTGNRESSDCADSRKNEKDEDSKERNFNENDVRSIDEEPRFSFRDDISIKS
RSLSLTSTCSLSISISADAEEMPTWMRSPELLALQHNLAFPESATASPVTLRRAHRCRRF
SVDLGEMRSLRLFFADPACTCGQLVVASRESQYKILHFHHGGLDRLAATLHQWHQLLYPR
LSADTEETLPYRHFMVCRPEVSRDELHPEEGQVPMITSLAWKDLLNERGQMEDDLALRKG
IFFGGLEPALRKIVWPFLLHCYSYQSTYEDREQIDAIRRQEYEEIQRRRLSMNPEHAERF
WRNVVCIVEKDVVRTDRGNPYYAGEGNPNIEVMKNILLNYAVYNCRLGYTQGMSDLLAPL
LAELNSEIEAFWCFAGLMQRSVAVCTPTDTDMDRNLCYLRELVRIMVPDFYTHLQNHEDA
LELLFCHRWILLCLKREFPTEIALVMWEACWVNYLTDHFHLFLCLAIMCVYADDVIAQDL
RTDEMLLHFSSLAMYMDGNVILRKARGLLYHFRQLVRLPCTLAGLCRQCGPGMWDSTHDP
VIECVGHEDTNCPYLNNYE
Download sequence
Identical sequences E2AFQ7
XP_011257349.1.72520 Cflo_11501--XP_396806.2_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]