SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_12344--XP_395554.2_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_12344--XP_395554.2_APIME
Domain Number 1 Region: 1-50
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000016
Family Tachycitin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cflo_12344--XP_395554.2_APIME
Sequence length 72
Comment [mRNA] [translate_table: standard]
Sequence
GYYADEAAGCQVFHVCHDVLVSSFLCPIGSTFSQKLLTCDWWTKVDCSASNRYLERNRDS
YQIDDDEMIRKA
Download sequence
Identical sequences E2AN70
Cflo_12344--XP_395554.2_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]