SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_15672--XP_623856.2_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Cflo_15672--XP_623856.2_APIME
Domain Number - Region: 50-133
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.000643
Family Complement components 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cflo_15672--XP_623856.2_APIME
Sequence length 146
Comment [mRNA] [translate_table: standard]
Sequence
HHRNARSAENIAAVSESVADDSNLSIPRRAQHLGLSYGSLWRILHLDLHFHPYKVQLTQE
LKPVDHGMRRKYADWVLEQQAVDGDFSTKIFFSDEAHFSLGGYVNKQNCRIWGNENPQVS
QERPMHPGKVWCAFWSGGVIGPYFFE
Download sequence
Identical sequences E2A7T8
Cflo_13736--XP_623856.2_APIME Cflo_13843--XP_623856.2_APIME Cflo_15672--XP_623856.2_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]