SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_01589--XP_395735.3_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_01589--XP_395735.3_APIME
Domain Number 1 Region: 92-544
Classification Level Classification E-value
Superfamily Sema domain 2.35e-126
Family Sema domain 0.0000539
Further Details:      
 
Domain Number 2 Region: 1433-1557,1811-1995
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.59e-41
Family p120GAP domain-like 0.031
Further Details:      
 
Domain Number 3 Region: 895-985
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000502
Family Other IPT/TIG domains 0.027
Further Details:      
 
Domain Number 4 Region: 1074-1144
Classification Level Classification E-value
Superfamily E set domains 0.000000000000642
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.08
Further Details:      
 
Domain Number 5 Region: 546-598
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000314
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 986-1074
Classification Level Classification E-value
Superfamily E set domains 0.000000000802
Family Other IPT/TIG domains 0.043
Further Details:      
 
Domain Number 7 Region: 1222-1283
Classification Level Classification E-value
Superfamily E set domains 0.000021
Family E-set domains of sugar-utilizing enzymes 0.054
Further Details:      
 
Weak hits

Sequence:  Cflo_01589--XP_395735.3_APIME
Domain Number - Region: 858-890
Classification Level Classification E-value
Superfamily Plexin repeat 0.000331
Family Plexin repeat 0.0043
Further Details:      
 
Domain Number - Region: 695-731
Classification Level Classification E-value
Superfamily Plexin repeat 0.00406
Family Plexin repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cflo_01589--XP_395735.3_APIME
Sequence length 2031
Comment [mRNA] [translate_table: standard]
Sequence
MRFLGLTQSFPKSFIVTPPLLFVYRSSFSSMSIATWFLVILATAAIDTPASTVPLMQDNK
SPHILAQFPAENGQRYGHFPLEANATREGALRFNHLTIDPSMGRLYVGAVNRLFQLDSNL
KLEEHVSTGPRMDNPQCHPTGCTARDITPSLMDNVNKLLIADLESQTLIACGSLLQGACE
KYKIANISVKPEFIPLSVAANDENSSTYAFIGPEKYNSWGQTNILYVGTTFTNKGDYRHD
VPAISSRNLDKLEFAEYTFNKQSIVYIDVKYRDHFLVKYVYGFNASDYAYFVLVQKQSYL
PEQEELGYISRLARSCISDPNYDSYTEVTLQCTVDLGDGKQHYYNLIQDAKVAAAGSDLA
MQLGISVGDPVFVTVFSPSRGITNEALSRSAVCIYSLQDIETKFNENIHMCFNGSIKYRN
MGYVSGPIQDGKCPTAGTTGNILNFCEVGLKISGVSPITGQAILHFPDTFISSITIANTE
SHTVAFFGTNDGVLKKVLLSGTEAFVYESVTIDKGQKLLPDTLISPDGDYIYVLSTSKVS
KVKVEHCSGYTNCSSCLDAKDPYCGWCSLEKRCTIRGDCQKASHSSPRWLSLGTGQQCID
FEQVLPDRMPINQMTTVQLTIRTLPELPTGANYKCVFGNAEPIDALMTGFGLSCPTPPVM
ERPSIPEGTDHALVPLSVRSSETNKDFVSRNFAFFDCSRHTVCTECVKSQWACSWCVYDN
KCTHNTSCQGIISGENQNQINLAPQGARHCPRFVERKERLRLPNSVPKEIVLEVENLPHP
QVGHSGFQCIVSIEGANLKVQARVDSSRLIVCDKTVYSYEAVTGEYEAEVTVVWNTNHHV
DKTTIILYKCEVLGSHREHADCSLCVTRDARFECTWCGNSCVYRHSCLQSPFAECPKPRI
DMIKPLSGPVEGGTLVTIEGSNLGLKESDVEGKIHIGKTPCTLVDYEVSVRIVCRTGRHE
ATDAASVMVGNDAGFTESAVLFNYKDIRLTGVYPSVGPQSGGTQLAITGKYLNIGSAISA
YLDELPCQVNATQASSTRLTCVTSKSGRVRRIHKLTLNIDGANRTLVDNPYNYTHDPTIM
EIKPLRSFVSGGRMITVHGTNLDTIQKPEMEVYFDNEPLPINRTVCTVLNPTQMECPSPS
ITKRFTSIRRNERSAVANVQGTSSPQSSRLKESHLSLKIAFIMDNVESVRDLEKHFQNLR
NRLFYVEDPKFFPFPRNVKLYKGDTLVIEGENLNYASDESDVNVTVGTMPCNVTSLALTQ
LVCTPPDQQPADTDELGIKTESGLPLVVVRVGRSLRFPIGYLRYEVIKSYTIPPEAIASI
AAGTFGLIFLFILVLVIYRRKSTQAEREYKRIQIQMDTLESNVRMECKQAFAELQTDMTD
LTADLESSGIPTLDHKNYIMKVFFPGVIDHPILNDPRSRSNVSRTNYDAAMIQFEQLVNN
KYFVLTFIETLEAQKDFNIRDKVNVASLLMVVLMGKMEYATDILMNLLLRLIDKAVNTKH
PQLMLRRTESVVEKMLTNWMALCMYNYLKDYAGSSLFLLFKAIKHQIEKGPVDVITHDAR
YSLSEERLLREQIEHTIVTLHVVQDDLDEKIQCKVLDCDTISQVKSKILDALYKNTPFSL
RPSVHDVDLEWRHGRGGHLTLQDEDLTTKCCGEWKKINTLAHYGVKESAVMSLIPRQNDG
FLVACKPPCQNCKPSHYHPQQQPSNHPHHPPSHHLHRHSNHCSSTHLPSTPNHGLISPVM
YNHPMSGLYFDSQHSPPIITANGDVESGHGGNQRLYHLVRPIEDVHYPPGLGFNSSSKHH
HPERTHKAIPEIFLTRLLSTKGTVQKFVDDFLNTILTANEALPSAVKWLFDLLDEAAKQH
GIIDPEVPHAWKSNSLPLRFWVNFIKNPDFMFDINKSTTVDSSLSVIAQTFMDSCSMTEH
RLGKDSPSNKLLFAKDIPHYREKVGRFYTDVQRLPQITDQEMSSAMQQLSASHANEFDVI
AALKELYIYVSKYYEQILEALETDAGCRKLHLAHRLENVAYTLEGEETSAC
Download sequence
Identical sequences E2ADR7
Cflo_01589--XP_395735.3_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]