SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_02112--XP_001122599.1_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_02112--XP_001122599.1_APIME
Domain Number 1 Region: 761-1056
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.73e-88
Family Complement components 0.0000207
Further Details:      
 
Domain Number 2 Region: 1131-1266
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 3.14e-34
Family Alpha-macroglobulin receptor domain 0.00068
Further Details:      
 
Domain Number 3 Region: 594-644
Classification Level Classification E-value
Superfamily E set domains 0.0000182
Family Arrestin/Vps26-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cflo_02112--XP_001122599.1_APIME
Sequence length 1310
Comment [mRNA] [translate_table: standard]
Sequence
MFRCIILDSRLRPSIVGPTDVYIIDGDGNRIKQWNRPPVTHGIYSSELELSQSPVLGNWK
IIANVGDQTFEKEFEVAEYVLPNFEVTIDSPKHVQFKESKITVFVHARYTYGKPVKGEAT
ITAYPDIFSGVIQPIFQQPVRKVVPIDGKAIVDFDILSELRLTDEYERPVMIDVVVEEAL
TTRRQNTSIQITLHKHKYTMELIKTSEYFKPGLKYTAFLKLTNHDGSPVQDTKNDVLIAY
GYSYDRSDYFNITKMLDQNGMIQLDLYPPKQKDNISFPLNIEAQYLNLHEWFPTTNSATS
LSNEYIQAVLKTEKPMVNNYVEIEVNSTAPLKYISYEVLGRGDILDAGSIYVQDKYTTSF
KFLATYVMAPTAHIIVYYVKTDGEVIADSLDVELAGVLQNFIDLKVTPGEVMPGESVNLV
ISAKPNSFIGLLGVDQRSLLLKSGNDISYEQVYKELQSYDRVKASPYTDSFFGRPLWSPG
SGTADDVFRKTGVVILTNGLVHESFPMLYYRANLDEALYASAAGFSGPAALPPEKVKVRK
NFPETWLWQTLDAGYQGKAELRRNVPDSITSWVLTAFSVSDAHGLGLIEEPRKLKVFRPF
FISMDLPYSVIRGEIVGIQIVVFNYMNKDLTAEVLLTNEGQFDFAEVSNEVHDVPKLELY
RRKKVDVKANSGSSVSFMIIPRELGYITIKATANSVLAGDSVEHKLLVNAEGETQYKNEA
VFLDLRNVENTGANITINIPNNAVLGSESIQISAVGDILGPSIPNLANLIKMPFGCGEQN
MLNFVPNIVILNYLKNTNQLTQAVQSKALKYLDTGYQQELTYRHTDGSFSAFGMSDPSGS
TWLTAFVVKSFKQAAEYIAVEDRIINEALEWLSNNQASNGSFPEVGKVSHRDMQGGAAKG
LALTAYTLIAFLENEDSVGKHRNTINKAVDYIVRNMEELNDTYALSLCAYALNLAKHPYE
TSAFNFLESMAMKKQGIKWWSKPIPKDDKNPHYSLPRSVDVEMTSYALLSYLRRNLVADA
IPVMKWLVKQRNTEGGFASTQDTVIGLQALAKLAEKLSKDTSSVRIAFKYGRDGQGYMNI
NSGNSMILQKQILPSKTRFVNITASGKGFVLVQVSYQYNLNVTGAWPLFTLDPQVDKNSN
PNHLQLSICSGFVPTKEANESNMAVMEVSLPSGFTVDRDSLPSLEISSHVKRVETRNGDT
MVVLYFDKMIKEEYCPTVSAFRTHKVAKQKPVPVSIYDYYDSSRRARVFYEARKTTLCDL
CEDEDCEDICVSKPGKQKDNATVSAASRIYTCVYLQLTFFSFYLLLHKYL
Download sequence
Identical sequences E2ACP6
Cflo_02112--XP_001122599.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]