SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_02678--XP_394261.3_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_02678--XP_394261.3_APIME
Domain Number 1 Region: 85-136
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000733
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 2 Region: 32-88
Classification Level Classification E-value
Superfamily Sema domain 0.00000183
Family Sema domain 0.025
Further Details:      
 
Domain Number 3 Region: 439-472
Classification Level Classification E-value
Superfamily E set domains 0.00000638
Family Other IPT/TIG domains 0.083
Further Details:      
 
Domain Number 4 Region: 391-429
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000157
Family Plexin repeat 0.0023
Further Details:      
 
Weak hits

Sequence:  Cflo_02678--XP_394261.3_APIME
Domain Number - Region: 232-269
Classification Level Classification E-value
Superfamily Plexin repeat 0.000314
Family Plexin repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cflo_02678--XP_394261.3_APIME
Sequence length 473
Comment [mRNA] [translate_table: standard]
Sequence
MRFIDRTFSRHDFCETIVWSLALDDEIEASLKCVVVESSTLALEYGDLEIDPGSPVNPDL
LFDSQLMHLYVLTEKKVSKVKVQECSVYKTCWDCLGAKDPYCGWCSLENKCNLRSDCQDA
AKDPLYWISYKSGRCTTITTVTPDQLQRTTARTLELVIENLPTLSGQFLCAFSALDKTLI
TNASRKSYGVNCTTPRTDLLPSIPPVRHHFTAKLSVRMTNGPDLVATNFTFFDCNTYSSC
TQCVSSSFPCDWCVDGHRCTHDTAENCRNDILVTGVSRMGPSYRSGPGFCPTINATESQE
ILVSSGIKKAIRVKVHIIGQFIIQTRFVCQFNIEGRVTSVNARLLADTIYCEETEFSYTS
RAPNITVPFAVIWGGSKPLDNPDNIHLVIYRCRDMADNCGMCLALPTKYGCGWCQSSDRC
EVKDQCDRGSGMWLNSNQTCPNPEIKSFEPVMGPWEGNTNVTIRGINLGKTFR
Download sequence
Identical sequences E2ANK7
Cflo_02678--XP_394261.3_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]