SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_03085--XP_001121246.1_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_03085--XP_001121246.1_APIME
Domain Number 1 Region: 155-456
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.56e-38
Family NodB-like polysaccharide deacetylase 0.026
Further Details:      
 
Domain Number 2 Region: 44-94
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000152
Family Tachycitin 0.028
Further Details:      
 
Domain Number 3 Region: 109-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000628
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cflo_03085--XP_001121246.1_APIME
Sequence length 518
Comment [mRNA] [translate_table: standard]
Sequence
MRSRNRFVLIALLAVSVNTATEKGKSEEVPCIDDNKFYRNPKTPSHNVWSPTECAKYFLC
LDNEVFEFKCSQGLLFDVSRQICDFKTNVDNCDVASDAQPAKPLLKNGECDDKNLACGDS
TCLPALYFCDGNVDCPDGSDEGWCDMQHDTNAAPACDTQKCRLPNCWCSKDGTQIPGNLT
ALAVPQMIAITFDDAVNAENFELYSKIFTDDRKNPNSCPIRGTFYISHQYTNYKDVQYLW
NIGHEIAAHSVTHRGPEEWWSKNATIEDWFDEMVGVANIIKKYAAVRIGDIKGIRAPFLQ
VGWNRQFLMMSEFGFAYDSSIVAPFSDPPLWPYTLDYKPPHPCVRTGQVCPTRSYPNIWE
LPLNQLLANEYTCTTVDSCPSNLSGEEIYKMLMLNFKRHYLTNRAPFGLHFHASWFQNPS
YFYAFNKFIDDVLRLDDVFFVTSHQIVEWMRKPTSLNEIEKFAPWQCTKRHFEPVEVACD
LPNSCKLHSKVLKSYRYLHTCFECPQQYPWLRNEFGIE
Download sequence
Identical sequences E2AJ61
Cflo_03085--XP_001121246.1_APIME XP_011259011.1.72520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]