SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_05206--XP_394526.2_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_05206--XP_394526.2_APIME
Domain Number 1 Region: 1556-1667
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-37
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 
Domain Number 2 Region: 1096-1205
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.28e-35
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 3 Region: 1211-1321
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-34
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 4 Region: 740-858
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-33
Family Spermadhesin, CUB domain 0.00055
Further Details:      
 
Domain Number 5 Region: 1797-1905
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-32
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 6 Region: 1440-1553
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-31
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 7 Region: 1323-1438
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-31
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 8 Region: 2806-2924
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-30
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 9 Region: 977-1089
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.94e-30
Family Spermadhesin, CUB domain 0.00058
Further Details:      
 
Domain Number 10 Region: 856-973
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-29
Family Spermadhesin, CUB domain 0.0007
Further Details:      
 
Domain Number 11 Region: 629-736
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.42e-28
Family Spermadhesin, CUB domain 0.00088
Further Details:      
 
Domain Number 12 Region: 510-625
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.22e-27
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 13 Region: 2225-2327
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-27
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 14 Region: 2334-2450
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.13e-25
Family Spermadhesin, CUB domain 0.00094
Further Details:      
 
Domain Number 15 Region: 3547-3659
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-24
Family Spermadhesin, CUB domain 0.00059
Further Details:      
 
Domain Number 16 Region: 1911-2018
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-22
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 17 Region: 3161-3282
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-21
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 18 Region: 2926-3039
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-20
Family Spermadhesin, CUB domain 0.00043
Further Details:      
 
Domain Number 19 Region: 3042-3153
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.16e-20
Family Spermadhesin, CUB domain 0.00093
Further Details:      
 
Domain Number 20 Region: 1669-1791
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-18
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 21 Region: 3437-3542
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-17
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 22 Region: 2690-2794
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-17
Family Spermadhesin, CUB domain 0.003
Further Details:      
 
Domain Number 23 Region: 2455-2565
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-17
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 24 Region: 3303-3365,3396-3437
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.42e-17
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 25 Region: 2047-2122
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000249
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 26 Region: 162-203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000678
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 27 Region: 2115-2188
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000275
Family Spermadhesin, CUB domain 0.0048
Further Details:      
 
Domain Number 28 Region: 469-510
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000387
Family EGF-type module 0.013
Further Details:      
 
Domain Number 29 Region: 198-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000015
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 30 Region: 330-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000216
Family EGF-type module 0.02
Further Details:      
 
Domain Number 31 Region: 432-469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00003
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  Cflo_05206--XP_394526.2_APIME
Domain Number - Region: 289-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000251
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 2568-2692
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000301
Family Spermadhesin, CUB domain 0.01
Further Details:      
 
Domain Number - Region: 380-417
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000471
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 254-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.046
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Cflo_05206--XP_394526.2_APIME
Sequence length 3672
Comment [mRNA] [translate_table: standard]
Sequence
MALTLGWFLLLHLSFCTAWMDERPVLESRDGHLIISSAKDRNITLKITGGGYMNVNEINL
LHVASAAQNATRVIDRWRMGYLAEMESSLHQLTTIVTGSTGLQRRVALLERSIDVNGTSR
VGNRSRIYPSFNPTRNTIRRINFRLKALEDSLRAMQTLLRENECQSNPCQNGGTCEDLFD
AYQCHCPSNWEGPNCMTDVNECARFLGTELGCQNGATCRNLPGSYRCDCLPGWFGLHCTQ
KTSICNTENSEALCGEHGVCVAKSSPLGYTCICDQGWESDGASPACTKDVDECAAYHPPC
SVNPPVSCHNTRGSFTCGACPHGYSGNGYYCTDIDECLINNGGCSTSPYVQCMNTMGSRV
CGACPSGYRGDGVSCIFVGGCAINNGGCHPLAICSENPSLTSSYVLCRCPPGYVGNGMGP
NGCQLADVSVNTACSVNPCVHGTCVPNGANGFTCTCNPGYSGTTCNTPTDPCSPNPCRNN
GICNVLNGQATCQCTSSYTGNRCETQRQTCGGVSRNPMGTLQFPMGGSTYQHGLSCAWVL
ITESSKVLNVTFTAFNLEQSTDCKFDFLQIHDGRNAGSQMINRFCGQTLPNGNGNIISSH
NTLYLWFHSDSSVSNDGFTFHWNSIDPVCGGVLEDNYGTIMSPGSPGRYPPNRDCFWRIS
VALSKRIQFHFGQLMLEEHCEADYVEITGMEEERLGFFCNHTRPPPLITPSFEATVHFHS
DNVGQDVGFQIHYSTIEGFPGCGGIYTSATGTINSPGHSSSGYQPNMVCEWKIQMPAGER
IRASWLRFNLEQSSSCHFDFVEIYDGPDRFSRLLGRYCGSDMPPTIKSNTNTLVVIFESD
WSYEFEGFTMSYETLCGGEFHEETGILKSPFYPNIYHGARTCIYEIIQSPNKGIVLTIED
MDIEGREPPNCYFDYIEIYDGYDENAKKLATLCGDEDYIPDSPYYSTHNIMYIKFTTDNS
IEGRGFKANYTTIDRRCGELLTKSPGVIRPPIESGVYADNEECIWTIQAPPGFVIQLAWL
SFNLESHYNCNHDYVKIYENYTSPTENIIATYCGNTKPPDLMTQNRTLTILFHTDSSITL
DGFVATYIFADVTKVCGGRYSKPNGVIRSPGYPEYYPNQKDCVWIIEAQNRHKITLTINQ
FELEKHTTCGFDYLEIRNGGYDSAPLIGKFCGTEIPTEIPSQTNQMYIRFVSDFSRSLQG
FEIQWDSTTEGCGGTMTTVTGDIMSPNYPESYSANADCYWKIAVAAGSLVQLVIIDFDLE
DHSKCRYDFIEISEGISHRTNGKRYCGTTYPHIIQSKSNLLTIRFRSDFSNSARGFHLKY
ETQCHNKLHGYYGVIESPNFPNKYEHSINCSWIIEAPIGNTINLTFSHFDLERGTLDTCT
YDYLLIMEGDEDNPNTELNRFCGTEFPSKISSTQHQVFITFITDSFIAFNGFRLEWTVHG
CGGHLSKPYDTFTSPGYPSGYPTNIACEWLIEVDYMHSVELTFHEINTEKRKGCLFDKLQ
IYSGDDADAPILAELCFSEKPIIYTSPGNKMFIKFQSDTSYAGRGFNASYKSVPIECGGK
FTTDSGIIHSPNYPQNYPHGQNCEWLLEVDSNHVVNLTFLDFDMENSRNCTDDFVKIFDG
PTKNHPLLATHCHTQLPPSYVSTGNQMLVAMRTDNIISAKGFKAQYVKACGARITVKDHG
FLTSSSGYSINQHDEANCTWTLIAENPGDHVTVTFTHMEIDPLELSTWDTTLGPCSWDYI
QVFEGDSTDGPLLGKWCNNVTPPPITSTGNSLTLHLFVRYEFAGHFVASYSVLNTACGGN
YTSAQGTITSPGYPNSYPLNAECIWILNTSPGNRITLSFSEFDIESSENCDLDYLEIRED
SGIGKLISVSCGKDVATITSSSRLWIKFKSDSSGTAKGFVGEYNFIFGNELEGPTGRITS
PLYPMAYRRTDKFSWRITVEMDSVIRIEFTDLQIENIGTSCFSRVEIYDGYDNEATSLLK
VCGYTLPDPIQSSSNVIYITMSTNFLRQGSWFDLTWLQIPRDISQDNKEIKLSDCNKEIA
LMGQRNNSYAFSSPGWPTGYDANLHCNWVFTSPPGTHLRLRIISMDLEETNDCIADSVSV
YSGYALTSTNNANLLNCGGNLTDPNGVIEYDNATFTRAIRTWRFTCEWLVTVKPGRTIKV
EITDMSIQEASDHSCSDNYVLVSKHIFFINFINKIINEILTFYIIIYFKVSMNCGGQFIF
TSTNNRWTISSPNYPNIPPTYTECTWTAIAPAGERLSIHFLDRFDLSYSENCEREYIEIR
DGGTDNSKFMGRYCKDIAPSSISTTGNMMYVYFYTDLPEPKNGFKAAIVSGEICGGILRG
TSGIITSPNYPYRYPVNQTCTWLLVGPTDHTMKLQFRDIQLPGFRQCDSTDHVKIAEKLA
ENDTTSEIGTYCGLQKPDIIETSTNEAYVYFQSDNREYISYRGFSLNFTTSQETCGGLLT
AMSGIIKSLGYPNPRTRPRHCNWRIKLPVGYQVVVNILDVDIVDDSGPTQVGYALSFYND
FSFKSKIKVLGQSASTEEIRSSSNTMIVNYWSSAGHRGFKLRYTAQAPAPCGGNLRQLEG
NITGPTSLPFNQTSYVCYWILEPPESMVGSIYDNRLTLTIKVTGYLGRSENRLGIIRKRC
IFPQFIELQDVGSLCGNITEPRYLRSPKMINMLTIMNGTYGERTNFNLQYQWQACGGILN
GLTHTIRPPKDISYPINCVWHINYPDGETIKLTFTKLELESNCDKNYLIVKNGGATAPQI
AKHCLHTANQLQKYNISSISNQLWIEYYASENRSDFEINVEPVNTGCGGSLSGRSREIAS
PEFPKQYPNKSECIWEIMGDNGYSIGLTFIDRFSLETSSNCEKDFVQVFDWIMAEGNGNG
EWKSLGKVCGRNTPTPFNSTSNRMKVIFHSDEAVQSDGFRAVWNENCGGIFKATERVNII
QSPSYPNLYPPNAFCNYTIVAPDEDIIVEFTDFQLERGRGDCRFDNVTITSETLYMDSIE
SDSYCGNNKPPLLKSISSLQIIFMTDKYSSRSGFQFKYFLNKCGGIITHPTELKPLMHGE
EYFGRMNCTWIIKAPQGKSIVVRFEKFVLEFSTSCYFDNVAIYEGALVKSDKRIALVCGN
LTEHLPIFKSESNSMVVNFNADSSRHFAGFTAKVLFTTSPVDGCGEFINMTSVQDKSFKT
QQAATYQSFEECHWTVVTSPGKTIRFTINSMDIKNSTIFNQSISVNQSDKCNGDYLEVRD
GAGPYAVLLGQFCGNVLPFPIISTSNMLWIRFYSDGTNEGAGATGTLNVVNALCGLNTRV
VNETVQILTSPGYPNTHTTGIQCRWILRHPDKYTDRLRIRFIDFDMTNSNKCEDEYLEIN
EQSKYINEGFGSDFIYNGIQHHPISVEMGSHFPVSSYKYCGSETPHDYYSYGDSIQLTFK
SLSNDHKGFKLEYSTANCDRNYTSEQGRIFHRGFTNCWITITAPQNHTISLYFNQFNIYD
TEHCTRNALQIHDGTSSGPLIRTMCSIATPSPIFSTGNKLTLHSWTTDFNSYQSYDIIYT
TTDAGRGCGGRIFNYGGKFTSPLYPNVYRNNTLCTWDVSVPRGFKIILEFTVFDLGTNKN
CGNNNVKIYDVVPSGELLRSTFCGGDDPARLEIDTDRILVKYTSTMNNIGTGWVISFMAQ
SAVHPINIIDGW
Download sequence
Identical sequences E2AK37
Cflo_05206--XP_394526.2_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]