SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_06956--XP_624644.1_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_06956--XP_624644.1_APIME
Domain Number 1 Region: 300-497
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.26e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0000329
Further Details:      
 
Domain Number 2 Region: 184-250
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000158
Family SH3-domain 0.002
Further Details:      
 
Domain Number 3 Region: 79-168
Classification Level Classification E-value
Superfamily PX domain 0.000000157
Family PX domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cflo_06956--XP_624644.1_APIME
Sequence length 1552
Comment [mRNA] [translate_table: standard]
Sequence
MPGPSTQERPRAHRLTDIESQAAKGLGGNRTDDFSTPVSSGSNMSGIARFPKLDECAHFH
YEHVELGTLEVSINEGPTNDSESYAVRITSGDACWTLQRSYDNFVMFDKQLHRCIFDRKF
SSLTKLPDVRPKNACDILKDYLSRFSQLNHEGLNCGPVLNWLQLDNRGRRILVPESDSCP
INTPAVAAAYAVRPYVAQAQDEISFQVGDMISVIDMPPAGESTWWRGKHGFAVGFFPAEC
VAVIGDKVPRHLTVSTTVRSKLPVKPVLRKHGKLIAFFRSFILNRPSRRRLKQSGILRER
VFGCDLGEHLLNSGQDVPTVLTCCAEFIEKHGLVDGIYRLSGVTSNIQKLRNAFDEDRVP
ALHSDESILQDIHSVASLLKMYFRELPNPLCTYQLYSTFVNAVQASSDAERLRRMRDAVR
KLPPPHYRTLEYLMRHLVRVAARGTETGMTPRNVAIVWAPNLLRCKELEVGGVAALQGVG
VQAVVTEFLVCYAELIFGDGPVGRPKSLAITTSARLLTLEEARNRSLRGEPDYIEVGAGP
AGLPLRYHTVIELPRKRNGSKRSPSLNWRALFGRGAVGKTRQIGTPPQVETVPSSLNSLR
RLRPVKSADSLDGEDGLGPLLGGPPPTRPCGHSRSVSHDSYFDHLADAPSAPSPLDLSEI
QLNFDLEEREMRMLSEEEGGGVASVEASPRRQRNESNQCVAPTGGSKRKRSRLEERLHCD
VELRFIDSQSPDQVMVATNADIHSIDSPSPLPTPGYLPLLSEASTPLTPATLQGTSHSTS
PIANSPRISFRSFTLPLEIGDERDSSNANKLKEAGVSSSEKLSDSSHRLSINLDDQNRGL
RSCERTSDGRIELRDRNVTMSHSDVENQAANQSSAVASIFNNTIEMTPCNRLSSLCEERK
SSGVTVSRKDATGGSSSLDSVKISSKSYDEKASATKERDKTTDSSDNLTAVVNLSRLSSS
NTTDFDSMMSCEQTLQELQESGFVICDNSDKAFTNTENPRVASNSNDSGDWVIIGRTTTG
SLATPISESTSPNDPFSEGGANPTTSPENDSETLLELTLTSTADTFCIGIDDTKSESHTS
VVQESERMILDVADTKKYTKNHKYEREDCANDPQTSFDLVNESNLADDSHSRLRDRENGN
RYSCTMADIDSNQESNAREQQQQVRACYIEADNANVFGTNRNDVSDEEKETLRETETFEN
YHHLSRDTSAQYSLHAINRPKFPDKSEDDRKRNTVSMTQDDRDNDHCSNELSNKCQSFGY
NNTQKQQTNTQQVRKCSSKRSDEGHKCVANLQTNQMQDNVEMRIPSENAAEPCEVAHAPE
GASELMERTLDTPSTSPTADDTVVLRDTAAILQELALQRLSGSAALGNASARRRYESETA
RDRRSFDSEIGREIVRERRMRQELDCARGKSEEPSQHLPPCLRARHARATRAALSRSLDE
AKFHRMTGEIPTLSVKQTSEDTQHCSTPNVGGSGSGVSVSEKIQLRNLGGLDLGDPQCRE
RIEKYKEERRMFLRDKYRSESFRGISSKAAEDDSEQALLTRLKQRASRPSLH
Download sequence
Identical sequences E2AJI4
XP_011259204.1.72520 XP_011259206.1.72520 XP_011259208.1.72520 Cflo_06956--XP_624644.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]