SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cflo_10536--XP_001122457.1_APIME from Camponotus floridanus v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cflo_10536--XP_001122457.1_APIME
Domain Number 1 Region: 723-776
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000024
Family Laminin-type module 0.00094
Further Details:      
 
Domain Number 2 Region: 623-674
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000121
Family Laminin-type module 0.0098
Further Details:      
 
Domain Number 3 Region: 177-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000614
Family Laminin-type module 0.077
Further Details:      
 
Domain Number 4 Region: 834-875
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000162
Family Laminin-type module 0.0071
Further Details:      
 
Domain Number 5 Region: 340-395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 6 Region: 779-831
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000614
Family Laminin-type module 0.0026
Further Details:      
 
Domain Number 7 Region: 293-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000067
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 8 Region: 237-295
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000297
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 9 Region: 683-725
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000795
Family Laminin-type module 0.0092
Further Details:      
 
Domain Number 10 Region: 585-625
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000949
Family EGF-type module 0.082
Further Details:      
 
Weak hits

Sequence:  Cflo_10536--XP_001122457.1_APIME
Domain Number - Region: 882-928
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000809
Family Laminin-type module 0.014
Further Details:      
 
Domain Number - Region: 987-1170
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0366
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0089
Further Details:      
 
Domain Number - Region: 1205-1413
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0811
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cflo_10536--XP_001122457.1_APIME
Sequence length 1497
Comment [mRNA] [translate_table: standard]
Sequence
MRTCAIWGPLLLVGSCVVLADPEADPSEELFNRLQQPKNRNEGKCYDENDRPQRCIPPFE
NAAFNVLMEATNTCGEDHPIEFCRQTGVQKKSCQTCQRGDHSASFLTDHDNNDNATWWQS
DTIYEGIEYPNQGRGETNGLRVTLDRLNTFGDEVFGDAHVLKSYYYAIADVAVGARCACN
GHAGECVNSTSVDGRTRRVCRCEHNTAGPDCNECLPFFNDAPWGRATTTDAHECRPCNCN
GYSDRCYFDKELYKAMGHGGHCLDCRANRDGANCERCRENFYQRLEDDYCVACNCDEIGS
RSLQCNSKGKCQCKPGVTGDKCDRCAANFYNFGSLGCTSCECSLAGSADNVPNCDSISGV
CVCKENVEGKRCRECRPGFFNLAVDNKFGCTPCFCYGHSSVCRPATGYSKLFIENMFVRG
NERWSASVAGNPIPLHYDALTQTISVTALDRDNVYFLAPDRFLGDQRASYNQDLSFILRI
GETGPAPTARDVILEGGNGEQITQPIFGQGNRLPTVTPQEYHFRLHEDSSYGWQPRLSSR
AFMSILSNLTAIKIRGTYTHQGRGFLDDVKLETAHRGAAGESADWVEHCQCPHGYVGQFC
ESCAPGFHHDPPNGGPFALCVPCNCNGHADICEAETGQCICQHNTAGSNCELCSRGYYGY
PLKGTPDDCKPCPCPDNGPCILLGNNPDPICSECPIGRTGPRCETCSDGYYGNPERGLAC
RPCDCNNNIDLNAVRNCNHETGECLKCVNNTAGFHCEECLSGYYGDALSDRREDGCKLCQ
CYPPGTSELDDGRVVPCDQLTGHCACKPHVVGRNCDKCEEGYYHIMSGEGCTVCNCDLEG
SYNRTCDPITGQCQCRPGVTGQHCDACEPYQYGFSREGCKSCDCDSIGSQDLQCDANGQC
PCLTNVEGRRCDRCKENKHNRQHGCIDCPDCYNLVQSAVNDHRRRLAELEDTLNKINSSP
TVIKDSDFEKELKNVQDRVKALLTSAKEGSNIENKTLAEQLDELREQLNTIDKIYQTVDV
TASDARDITEEGLTNMDEAEKVLDIIFDQLKEAENYLATDGANALAAAKLRAEQVGQQNR
QMTSIAQEARVLAEINTNEAKKLHMLAEQARNTTLEAYNLAKQTISKYSNITDEIRGLEN
KLAQLEDRMDEVRNLTAIAAAKSSAVSQEALDLLILDLTLPTVDLEQLRQQVETVSNEGL
RIKEQAQLLLEQNENFIKEMSEKVKNSEELLDRAQDQQAATAEHLAELDEANETANDAVK
RGDQTLKEAQETLKKLGEFDAEVQRERIKAQDALQDIDDIEKLIESASMQAKEVERVLNG
SEDKASANANNIRMEANKTKIAVLRLGNEAEKLHLRVDTTDSIMKEYEIQMTEDANVTAE
ANHKVGQAKINVTLASQQVDKALSDVAAIIRELENLPEIDDVDLNRLEERLVAAETEIKA
ANLDQRIRALTEAKNLQTQWVKNYEDEVSRLRIEVENIDDIRKALPTDCYQRLRLEP
Download sequence
Identical sequences E2AN97
Cflo_10536--XP_001122457.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]