SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G000380_P04 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GRMZM2G000380_P04
Domain Number - Region: 26-254
Classification Level Classification E-value
Superfamily Tropomyosin 0.0024
Family Tropomyosin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G000380_P04   Gene: GRMZM2G000380   Transcript: GRMZM2G000380_T04
Sequence length 416
Comment seq=translation; coord=4:122481971..122484085:1; parent_transcript=GRMZM2G000380_T04; parent_gene=GRMZM2G000380
Sequence
MAQPENGVRPPLLRTDMEEPPRVSDGSATKERVRLLEREVASAKQREMKMLESLVQQTKE
LEQAKIALEEASLEVATLRQQQQQQGEGGAAAEPAVQAQQWSVMDLMFGGVDEEINGLRA
KLRAAQQAEERSRKAADELAAALSAVTVEAKQVKAWLSGAQAEVEASNAEADRLRGLLQG
AEAELWSATEQVGALTSNWKDAAAGWRAREKALVARARAAEEDAAAARRDNAGLRRALEQ
AVEEANAAAEALEAAGADNAGLQEAVAEKERALEALRRDNEGLRASEAAARARAEELQGQ
LAAKEREIPLVEKWRREDAQGKLVSSGMFLGSGRLVPGRKDRMFASLSNIAELKSAAAAA
AAMDDYGYEFDHLDVGQPCDDATEHKIKRRSILRKVGDLFRRRRSPNLAPVLHDHY
Download sequence
Identical sequences A0A1D6Q3K9
GRMZM2G000380_P04

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]