SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G009795_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GRMZM2G009795_P01
Domain Number - Region: 90-171
Classification Level Classification E-value
Superfamily Tropomyosin 0.0144
Family Tropomyosin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G009795_P01   Gene: GRMZM2G009795   Transcript: GRMZM2G009795_T01
Sequence length 187
Comment seq=translation; coord=10:17645537..17650759:-1; parent_transcript=GRMZM2G009795_T01; parent_gene=GRMZM2G009795
Sequence
MAAQREKSAAVAVGPAHGAAVSGSPSPSSSSGGPAAASSSGERWSAAIGNLGELGANVDA
LQKMLGRKAVFVDDDIFSKASLAADQARTIKVLDQRVQSLERELDAAISAAARARTDKRQ
AEAAQRAAELRTQEVTKELENTARVFQLHMEELRLKQEEIAKKDSDIKVLEAIIRTLGSK
DDDGSSE
Download sequence
Identical sequences C0P9D4
NP_001168817.1.34533 GRMZM2G009795_T01|PACid:20873757 GRMZM2G009795_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]