SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G018823_P02 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GRMZM2G018823_P02
Domain Number - Region: 114-232
Classification Level Classification E-value
Superfamily Tropomyosin 0.000981
Family Tropomyosin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G018823_P02   Gene: GRMZM2G018823   Transcript: GRMZM2G018823_T02
Sequence length 267
Comment seq=translation; coord=6:119201584..119204048:1; parent_transcript=GRMZM2G018823_T02; parent_gene=GRMZM2G018823
Sequence
MHDRSHKPQPPEAGEGAGGGNVDRVLFKNLVEMVPLVESLMDRRVNSAYSRRTSLVYTPA
PPKKASELESVKLPQSVSAKKRRDPGDVSKKSTPDSNGDNGLVVPLSLSGAENKPKDDVA
GLREQVDYLQKKLLEKEEALRSAESLVTEMNAAYATIDELRRLVSDKEALIRSTNSQLHD
AKIMLADKQASVEKLEWEVKMSNKKVEDLQGDVSNMGFEISSLMAFFDKISENLSGDSYD
DTVPSSYELEAIQSTVSMHPWSNVWPV
Download sequence
Identical sequences GRMZM2G018823_P02 GRMZM2G018823_T02|PACid:20824742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]