SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G048928_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GRMZM2G048928_P01
Domain Number - Region: 443-547
Classification Level Classification E-value
Superfamily Tropomyosin 0.000458
Family Tropomyosin 0.0032
Further Details:      
 
Domain Number - Region: 362-441,469-494
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0497
Family HBL-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G048928_P01   Gene: GRMZM2G048928   Transcript: GRMZM2G048928_T01
Sequence length 586
Comment seq=translation; coord=2:163492175..163498588:1; parent_transcript=GRMZM2G048928_T01; parent_gene=GRMZM2G048928
Sequence
MADVDDDAVLSDVDEDPLPPPSTSSASSHKSLPQAQPQSQSDAQAQQQRLLDLAAELEEE
RRLRRAAEASLAEAEPRVARFKAFALQAEAATASSMLSSGFERISAKASPSSPPAPLPTS
QKYSSGLPALAYGVLKRANDIVDELLAQIDAANRDRDRAREQMEHRNYQIAIEVSELEAS
LASRSAEGESLSKSLSQREAEISELRDKITSLEGKLAAQRPVLAEQIGCTSKLYHEMREV
VKLVDAEAVSALSDSVFVWKETDVEESLKVSLEGTKLAYELAAIALEKVGACIDDKESKL
RRLENMVDGLIKEKEHISVLLRNALQATTSEVLKVAEDGLREAGIEIGLNERKEHMLGSV
EKDEVYTLAGALENTMKESQVKIIELQHLVEALRAESGLLRTRLEGQEKEIGQLRKQIKN
LEEKEKVANESVEGLMMDVTAAEEEIKRWKMAAEEEAEAGRSIEQEFQIQISSLRKELDE
ANRAMVELENKLKFKEETAAAAMAARDAAEKSLKLADTRSSRLRERLEELNKQLEESDTR
TESVNRNGHRYMCWPWQWLGLNYVQLPLAETDQTSNEMELSEPLII
Download sequence
Identical sequences B7ZXP5
GRMZM2G048928_T01|PACid:20841902 GRMZM2G048928_T02|PACid:20841903 GRMZM2G048928_P01 GRMZM2G048928_P02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]