SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G049495_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G049495_P01
Domain Number 1 Region: 24-184
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.93e-31
Family Ankyrin repeat 0.00033
Further Details:      
 
Weak hits

Sequence:  GRMZM2G049495_P01
Domain Number - Region: 6-32
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0732
Family Second domain of FERM 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G049495_P01   Gene: GRMZM2G049495   Transcript: GRMZM2G049495_T01
Sequence length 195
Comment seq=translation; coord=2:1124849..1126316:1; parent_transcript=GRMZM2G049495_T01; parent_gene=GRMZM2G049495
Sequence
MPSEYARNAWHKLGAMPTEEAMQGYITIVQDLFPNWDAGASAKRKDEDSIASASASKGPM
GPVFSSLMYEEDEGNESELGDIHVSAREGATDDIVKLLAAGVEVNVRDTEGRSPLHWAVD
RGHLSAVEVLANANADLNAKDNEGQTALHYAAVCEREDIAELLVKHHADLRIKDEDGNTA
HDLCPSSWSFMNQAN
Download sequence
Identical sequences GRMZM2G049495_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]