SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G057380_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G057380_P01
Domain Number 1 Region: 169-937
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.58e-259
Family Motor proteins 0.000000000132
Further Details:      
 
Weak hits

Sequence:  GRMZM2G057380_P01
Domain Number - Region: 937-985
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00212
Family Motor proteins 0.06
Further Details:      
 
Domain Number - Region: 1026-1199
Classification Level Classification E-value
Superfamily Tropomyosin 0.0589
Family Tropomyosin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G057380_P01   Gene: GRMZM2G057380   Transcript: GRMZM2G057380_T01
Sequence length 1238
Comment seq=translation; coord=7:151904280..151913926:-1; parent_transcript=GRMZM2G057380_T01; parent_gene=GRMZM2G057380
Sequence
MLSAASVMAPAAATQKSSLEVLLETLKKRDEQPKDAPPTLPARPTCRGRLPTTRRSSLPA
GFMLENGMATVAATEAAVVDKKADAKMEIVGLEAKEEKLVKGCIFGTKRKFPNTEVLEES
PYVGKFLEERKGTSVCKNPPHISSATIRMNGNVACTDILDYILQKKLRVWCSSPNAKWEL
GQIQSMSGDDAEILLANGKVLMVSPEQLLPANPDILDGVDDLIQMSYLNEPSVLYNLQLR
YSRDLIYTKAGPVLIAVNPLKEVALYGKSSIMQYKQKANDDPHVYAVADLAFNEMLQDGI
NQSIIISGESGSGKTETAKIAMQYLSDLGGASGTESEVLQTNVILEALGNAKTSRNHNSS
RFGKLIEIHFSESGKMCGAKIQTFLLEKSRVVQRAQGERSYHIFYQLCSGAPPLLKKKLF
LKSANDYNYLKQSNCLKIDGVDDSKKFTVLVDALDTIQISKEDQMKLFSMLAAVLWLGNI
SFCVIDNENHVEVVSNEGLSTAAKLLGCTANQLVIALSTCKIRAGNDSIVKKLTLTQAID
ARDALAKSIYANLFDWIVDQINHSLGTGRQFTWRSISILDIYGFECFNKNGFEQFCINYA
NERLQQHFNRHLLKLQQEEYLEDGIDWTPMEFVDNTNCLSLFEKKHLGLLSLLDEESTFP
KASDFSFANKLKRQLSGNSCFKSEKEGTFKICHYAGEVTYDTAGFLEKNRDPLHSESIQL
LSSCTCELSKHFASVMVADSQNKSSLSWHSVKDTHKQSVVMEFKAQLFKLMQQLESTTPH
FIQCIQPNSKHHPRLFEHDLVLHQLKCCGVFEVVRISRTCYPTRITHQQFAERYRFLLLR
SIASQDPLSVSIAVLQKFNIPPEMYQVGYTKLFFRTGQVAALENAKRQMLLGTLHIQTQF
RGLHSRRGYQRLKKGAMNLQSFIRGERTRIHFDNLVKRWRAAVLIQKHTRRRLAANMFND
QLNHVILLQSVTRGFLARRKYKCLQNEKESKASHSIVQGNTRKNNSESRICHEMNGHYPH
EPVITELQGRITKAEAALRGKEEENVMLKQQLEQYERKWSEYEAKMKCMEEAWKRQLSSL
QLSLVVAKKSLAADDAATRAARTDCTPTHAQYDSEDTLSTGTRTPEVIESKHDNHNPEAK
VSAGNSDRRVNAVNHLAKEFEDRRQVFEDDAGFLVAVRSGQIGSNMNPDEELRKLKDRFA
TWKKDYKSRLKETKVNLSKVGTHDEKSRKRWWGKKSSK
Download sequence
Identical sequences GRMZM2G057380_P01 GRMZM2G057380_T01|PACid:20834123 XP_020396728.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]