SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G070553_P02 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G070553_P02
Domain Number 1 Region: 79-345
Classification Level Classification E-value
Superfamily Kelch motif 4.64e-51
Family Kelch motif 0.0075
Further Details:      
 
Weak hits

Sequence:  GRMZM2G070553_P02
Domain Number - Region: 548-657
Classification Level Classification E-value
Superfamily Tropomyosin 0.0301
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G070553_P02   Gene: GRMZM2G070553   Transcript: GRMZM2G070553_T02
Sequence length 695
Comment seq=translation; coord=4:3117015..3124482:-1; parent_transcript=GRMZM2G070553_T02; parent_gene=GRMZM2G070553
Sequence
MPKMFGFSRRRMKLGRLKGHLHDHFHGPRSPSRTTKRSSSHHNAEDPLATSVSGRADDLA
WRCSSDTFDLNGRDFESSENWAVLSTEGDKPAPRFDHAAAMVGSKMVVFGGDSGQSLLDD
TKILSLDKLTWDSVAPKVRPPLNGRSLKLRPCRGHCLVSWGKNVILVGGKSDQPYDKISV
WTFNTESELWSHMEAKGDIPVSRSGHTVIRAGPVLILFGGEDAKGKKLHDLHMFDLKSLT
WLPLNYKGAGPSPRSNHVAALYDDRVLLIFGGQSKSKTLNDIHALDFETMVWSRVKTHGH
HPSPRAGCCGALCGTKWYIAGGGSKKKRHPETWVFDVLESRWSVCVVPPSSSITTKKGFS
MVPLYYRDKIVLVAFGGNKKEPSDKVEVLVVLQNEHCFSWRSAPEVEPLLYDESPPGSRE
LADHLSSCAPPYPTSSAARSGLAATAENSCGRKPLPDSLLRTSNLGGSSLRRQFRQEEEC
SSLAQKLQKPIDDDRYKDAADECSEHQPPSATNPKPRNDARRSSPEVVVDAKARRLLGRS
SSDMNNHQDARVAALVRRNVALEEQLSAALASKDEAEKNLSLVIDSKDGLEKRLAEKDRE
VEALREKATGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGE
RARAFQLQVRPYHARLSFFLFFVHALGSARLKSFI
Download sequence
Identical sequences GRMZM2G070553_P02 GRMZM2G070553_T01|PACid:20857320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]