SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G070553_P03 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G070553_P03
Domain Number 1 Region: 79-345
Classification Level Classification E-value
Superfamily Kelch motif 4.64e-51
Family Kelch motif 0.0075
Further Details:      
 
Weak hits

Sequence:  GRMZM2G070553_P03
Domain Number - Region: 549-684
Classification Level Classification E-value
Superfamily Tropomyosin 0.00687
Family Tropomyosin 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G070553_P03   Gene: GRMZM2G070553   Transcript: GRMZM2G070553_T03
Sequence length 695
Comment seq=translation; coord=4:3117047..3124482:-1; parent_transcript=GRMZM2G070553_T03; parent_gene=GRMZM2G070553
Sequence
MPKMFGFSRRRMKLGRLKGHLHDHFHGPRSPSRTTKRSSSHHNAEDPLATSVSGRADDLA
WRCSSDTFDLNGRDFESSENWAVLSTEGDKPAPRFDHAAAMVGSKMVVFGGDSGQSLLDD
TKILSLDKLTWDSVAPKVRPPLNGRSLKLRPCRGHCLVSWGKNVILVGGKSDQPYDKISV
WTFNTESELWSHMEAKGDIPVSRSGHTVIRAGPVLILFGGEDAKGKKLHDLHMFDLKSLT
WLPLNYKGAGPSPRSNHVAALYDDRVLLIFGGQSKSKTLNDIHALDFETMVWSRVKTHGH
HPSPRAGCCGALCGTKWYIAGGGSKKKRHPETWVFDVLESRWSVCVVPPSSSITTKKGFS
MVPLYYRDKIVLVAFGGNKKEPSDKVEVLVVLQNEHCFSWRSAPEVEPLLYDESPPGSRE
LADHLSSCAPPYPTSSAARSGLAATAENSCGRKPLPDSLLRTSNLGGSSLRRQFRQEEEC
SSLAQKLQKPIDDDRYKDAADECSEHQPPSATNPKPRNDARRSSPEVVVDAKARRLLGRS
SSDMNNHQDARVAALVRRNVALEEQLSAALASKDEAEKNLSLVIDSKDGLEKRLAEKDRE
VEALREKATGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGE
RARAFQLQVEVFHLKQRLQTMEGRSPAAPRKPQNA
Download sequence
Identical sequences A0A1D6PPA8
GRMZM2G070553_P01 GRMZM2G070553_P03 XP_008677101.1.34533 XP_020407077.1.34533 XP_020407078.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]