SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G092232_P02 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G092232_P02
Domain Number 1 Region: 273-629
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.21e-122
Family Motor proteins 0.000000359
Further Details:      
 
Weak hits

Sequence:  GRMZM2G092232_P02
Domain Number - Region: 169-273
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00133
Family Myosin rod fragments 0.011
Further Details:      
 
Domain Number - Region: 606-706
Classification Level Classification E-value
Superfamily Tropomyosin 0.00654
Family Tropomyosin 0.0075
Further Details:      
 
Domain Number - Region: 676-885
Classification Level Classification E-value
Superfamily Tropomyosin 0.0229
Family Tropomyosin 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G092232_P02   Gene: GRMZM2G092232   Transcript: GRMZM2G092232_T02
Sequence length 965
Comment seq=translation; coord=1:3103305..3109298:1; parent_transcript=GRMZM2G092232_T02; parent_gene=GRMZM2G092232
Sequence
MEGAEALFPGDGCGGDPMDFSWTADGEKHPDPAACASPGRDDEATSASTPVPSPQEMAES
MILVPGPRVVMSGLRLADCRSDDCVLFINAGGGAIESCDPCVKVSGDSFFEGGDVIETNE
SIAEVVGGNRALQVRDIRVTVEMNGAVMINFKGVRGSPMVCGICIRKAPLLSVQTLGRES
DQLRNVSRKYKNDKKLWVAAISNLERKIKAMKQEQQLLSLEAHDCANAIPDLSKMIGAVK
GLVAQCEDLKLKYYEEMDKRKKLHNIVQETKGNIRVFCRCRPLSKDEVSSGQKCVVDFDG
SSDGDIVITNGGTKKTFKFDRVFTPKDDQDIVYADASPLVTSVLDGYNVCIFAYGQTGTG
KTFTMEGTESNRGVNYRTLEELFNIAEERKESVTYDLSVSVLEVYNEQIRDLLATSPSKK
LEIKPNSEGQNHVPGLVEAKIENINEVWKVLQTGSNARAVGSNNVNEHSSRSHCMLCITV
RAKNQLNGECTSSKLWLVDLAGSERLAKTDVQGERLKEAQNINRSLSALGDVISALATKN
SHIPYRNSKLTHLLQDSLGGDSKALMFVQISPSDNDVSETLSSLNFASRVRRIELGPAKK
HVDTAELQKTKQTLERAKQELRLKDDSLRKLEENLQNLESKAKGKEQLCKNLQEKVKELE
GQLDSKAQCQITSEKQQRQLSGKLKEKEEMCNVLQQKIADLECKLRQPQQSESEVALLKQ
TIQELEVKLKEQQHDRSAMELSIKEMELRFKEEEHQRSVAELKIKELELKLKEQEHQRSV
AELKAREIGHELLETQRTESMLQIKLRELESKAKEQDTNMTAVVESRVVVATPVNAKVMS
EKENHVLRISNSLNKQLAHVENTPEAPEAACNERKRKGEARNASIGGGEQENTNNGGRKR
SLPAEREARLKRKSTEPPPQVKNLVRSTASSRAAAKAAAAAAPSSRAGGAKQQPGGGNKT
RGWVR
Download sequence
Identical sequences GRMZM2G092232_T02|PACid:20862021 GRMZM2G092232_P02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]