SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G129444_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G129444_P01
Domain Number 1 Region: 487-573
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00000000000536
Family Mitotic arrest deficient-like 1, Mad1 0.0025
Further Details:      
 
Weak hits

Sequence:  GRMZM2G129444_P01
Domain Number - Region: 85-220
Classification Level Classification E-value
Superfamily Tropomyosin 0.000654
Family Tropomyosin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G129444_P01   Gene: GRMZM2G129444   Transcript: GRMZM2G129444_T01
Sequence length 716
Comment seq=translation; coord=3:170792547..170823461:-1; parent_transcript=GRMZM2G129444_T01; parent_gene=GRMZM2G129444
Sequence
MILRTPPQRKRRAGSGAGDDADLGLVKSVGVASATGRSPVSDRRLALYDRPTALALADAP
GEPFDDMVCTYHCRQMVKSEFMVALDTAEKQVQEYQTKLVALEDQLSKSEDERMQFLDKL
NYVEQELAATKGRESALQERLLKELGEYQERYRGQVMKINELEVQLNKEIDSRISAESSV
SSAKALIKDLEGDLHRLSESSEREKKTLKKELSYVKEDLSLSASKNNAELEKTILRAENY
ESEAKLLNEQLTNLKKQLDECLSEKNEMELKLLNSSALPNQHAPTEEQKLIKLLQEELRN
YEKEVHEAKRLKSSHMNVELLKEKLLEEQGRRERAELELSKLQEIGARAHKLELELASCT
ALLSNIPDVSSYADIPQKIADLQKQALTYLNEVGEVTSRLKELEVALEYADLSKQQAEGE
AALAKERAASATREVKRLELMLTAISEERDKLRKEHATESDQSGMEKTIRELESIIHELK
ELISHKDTELNIMNERLNLETRKVKSLEREGDQLRSQVALLESKLGHGDYSASSTKVLRM
MNTLGVDNEAKQTIEVLQAELKKTKERLQAVEELKGQTDPGTVVDANIAEKLAQLKNQIA
TLEKREERYKAVFAERISVFRKACCSLFGYKIVMNDQQQSNGIPVTRFILQSVYAQSDDE
KLEFDYESGSTNIVVNDYTSQQEIARQVDIYIRRTNSIPAFTANLTMESFNKRSIC
Download sequence
Identical sequences B6U4F6
NP_001151757.1.34533 GRMZM2G129444_T01|PACid:20830755 GRMZM2G129444_T02|PACid:20830756 GRMZM2G129444_P01 GRMZM2G129444_P02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]