SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G137704_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GRMZM2G137704_P01
Domain Number - Region: 111-206
Classification Level Classification E-value
Superfamily Tropomyosin 0.00196
Family Tropomyosin 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G137704_P01   Gene: GRMZM2G137704   Transcript: GRMZM2G137704_T01
Sequence length 221
Comment seq=translation; coord=6:135495936..135502909:1; parent_transcript=GRMZM2G137704_T01; parent_gene=GRMZM2G137704
Sequence
MIQLLFSLLAAEAALVLALLFPTPVRRLALLAIDRAKRGRGPVMAKTIAGTMLLVLVSAF
YSVAKIRRREGELGQLTPTDQVLASRHLLEASLMGYSLFLGLIIDRLHHYIRELRMLRKD
MEAVTEQGRTLEAAKSGSTDEIQGYQKEVASLKEQVQELQNQSQKKTERLKTAEANSVAL
QKQSEGLLAEYDRLIAENRDLRDQLQSIDLRLSHSGGKKNS
Download sequence
Identical sequences A0A1D6M104
GRMZM2G137704_P01 GRMZM2G137704_T01|PACid:20820858 XP_008649481.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]