SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G172900_P02 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G172900_P02
Domain Number 1 Region: 1-145
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-42
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G172900_P02   Gene: GRMZM2G172900   Transcript: GRMZM2G172900_T02
Sequence length 148
Comment seq=translation; coord=5:178628060..178630029:1; parent_transcript=GRMZM2G172900_T02; parent_gene=GRMZM2G172900
Sequence
MEQYEVVEQIGRGAYGSAYLVLHKAERKRYVMKKIRLSKQNDKFQRTAYQEMSLMASLSN
PYIVEYKDGWVDEGTSVCIVTSYCEGGDMAERIKKARGILFSEERVCRWFTQLLLALDYL
HCNRVLHRDLKCSNILLTRDNNIRLGKM
Download sequence
Identical sequences GRMZM2G172900_P02 GRMZM2G172900_T02|PACid:20877748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]