SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G174596_P03 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G174596_P03
Domain Number 1 Region: 1-187
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-64
Family Protein kinases, catalytic subunit 0.000000678
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G174596_P03   Gene: GRMZM2G174596   Transcript: GRMZM2G174596_T03
Sequence length 196
Comment seq=translation; coord=4:244037619..244042162:1; parent_transcript=GRMZM2G174596_T03; parent_gene=GRMZM2G174596
Sequence
MDQYEKVEKIGEGTYGVVYKGKDRHTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQH
RNIVRLQDVVHNDKCIYLVFEYLDLDLKKHMDSSTDFKNHRIVKSFLYQILRGIAYCHSH
RVLHRDLKPQNLLIDRRNNLLKLADFGLARAFGIPVRTFTHEVVTLWYRAPEIFSVQGII
PPLLMCGQLVAFSLKW
Download sequence
Identical sequences B4FUF6
GRMZM2G174596_P03 GRMZM2G174596_T03|PACid:20860697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]