SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G324390_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G324390_P01
Domain Number 1 Region: 420-532
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000139
Family Myosin rod fragments 0.0031
Further Details:      
 
Domain Number 2 Region: 490-637
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.000012
Family HBL-like 0.073
Further Details:      
 
Weak hits

Sequence:  GRMZM2G324390_P01
Domain Number - Region: 996-1144
Classification Level Classification E-value
Superfamily Tropomyosin 0.00477
Family Tropomyosin 0.0053
Further Details:      
 
Domain Number - Region: 17-177
Classification Level Classification E-value
Superfamily Tropomyosin 0.00654
Family Tropomyosin 0.0091
Further Details:      
 
Domain Number - Region: 904-984
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.051
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G324390_P01   Gene: GRMZM2G324390   Transcript: GRMZM2G324390_T01
Sequence length 1625
Comment seq=translation; coord=1:239353342..239359084:-1; parent_transcript=GRMZM2G324390_T01; parent_gene=GRMZM2G324390
Sequence
MQIEAALLMTEGLHSQLQEKMQMLTQDFDGSTKKLSELENNKLDLESTLKELNNTILGLN
SEKDAALLQQQQSLQKVSNLELELSMMQLEMDKSEQKILLLEQEIARKNGSVDSLEISLK
DECEKRLQAQKMYSQSQEDVSRLYIEIEKQNGKLNELENLISELNNTILLINTEKDATLH
ENQQSSVRISDLESELMALKTELENVEGKVHAVEQELIYKKEEADNLQISLQDEIQKRVE
GEESLLMMTNLHSGSQNEVRGLALELEKLNGNLRQVENSKVDLENIVTKHTEEIHILRER
NLSTDLMIKDLHLELDALKDLNVKLQTEMGLHIGEKEALQREFTSQREEKKNLEGIHHTL
VDEMSTLKTTATMNQKLIEELQITNSKLKEVCAKSEVEKALLSEKLQEVEKLSEECSLLE
NSLSDANAEMDALRDKIKALEALESSLKDIISCHVSEKAVLVSELEILGKRLSDASEKNS
IMDSSLFDMKMDLEDLRTKLKDSEESCQALLANNSALSGEVDALREKIKALQDSESSLKD
AISCYVSEKAVLASELEILGKSLSEVSEKNSILDISLCDMKTELDELRTKLKDSEESCQA
HLTNNSALSAEKNNLFSQLESITLAMKALEGMHANLEQKHSSVSREKDFAYDQVRELQDQ
LRIKNEEFEVSAKSHQLQANSYEKQIFSLQEKNHYMEEVLQQEQQKNINASISTVILENC
LVDEQDKKVALFTECQKYAVENHSANMLVSELMEEARYHGEERKKLLAHNEKLREGISNQ
MKFLNICKDLGPADLAEDEVLLQTVSDETINIMRLKDETEDVNRLMDTELSVLSVVLLQV
GMELRDLHLQKCALEKEVESGEKETLSLQNQNQQMLEQNEQLRSGLQESSEGVEVLKTEV
FVIQEKLSCLRESYQTSQDEISNLTKKNESLSKEYQSLSEKYNALEDENDTIFEECMMLK
NLCLFFRGHNNEIASALASLTDEMALLSLAKGDLDLQVNELNRRSVMLESENYHLKDYII
YLVEILRTRLVLSEFDLDTNRSVFQELVVELENCMTQLVQKDDELMEAEEKVQLLQEKNR
ELCGVVGSLQVAMEGAKVVKGELEKKITILIEQCSSKDDKILLLHQDNEALQSEIEQCER
EFVELMDDAITFSVNSAVYEEKAFELMMNGKATENRAISQKELLMKEISSRDANIEELQK
RLAGIQDEHAELKAELNTHLALIASLVDHVSVLEEDVRSLSKPCSTEGKEETARVHHVQE
GDDGLESHCLVNGTPKLQGLIARIEALQVVVLNAKDRQDRKSAESAAKLAAASAEIQELK
TRGGSRMEAKEICSDNEKQDVEVSKGKQVQIMKDIELDQISTCPPYGAGAALYPHGTGAN
AELDDDMLQLWEAAERSCKNQTAKSSSSEHDIQAVEDLESECPSSELARGRDLGTNKLEV
PKGAVEPHEAWSKNVLERLTSDAQRLLSIQASIEELKKKMEGSSKGTNSEYGSVSAQVHE
TEGLVLEQINSNNKLSRKAENYPALSDNTSTERGGYSSRRKISEQVQRGSENVARLELEL
QKIQYVLLKLEEEHEYTRLKVSDKRTRVLLRDYLYGRKDRGGGQKGKKKRVPFCGCVRSK
SRTEP
Download sequence
Identical sequences GRMZM2G324390_T01|PACid:20869001 GRMZM2G324390_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]