SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G324467_P02 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GRMZM2G324467_P02
Domain Number - Region: 381-457
Classification Level Classification E-value
Superfamily Tropomyosin 0.000883
Family Tropomyosin 0.01
Further Details:      
 
Domain Number - Region: 226-235,368-391
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.022
Family Formin homology 2 domain (FH2 domain) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G324467_P02   Gene: GRMZM2G324467   Transcript: GRMZM2G324467_T02
Sequence length 533
Comment seq=translation; coord=9:142055702..142061334:-1; parent_transcript=GRMZM2G324467_T02; parent_gene=GRMZM2G324467
Sequence
MSARRAAKSQHAAATPRTINLNLARRPGGGRPSRGAGRAQTRPAPPQPARQVQVNLGALF
EMERRVRGLESAPPSPAPASQSQEDAEEREEKWQFQAEILRAECNFLRMEREVALRKLDR
HRGQMEAALKSAVETLVSGRKKVDGKGDVGVAAALDEGIEDLEEMMEELRVEKESGRRAM
GGARELQRSRGRNFDRQASSLRRRLEKMPPANPDPLVKDIREIALPVPAPPPPPPAAEQS
GDDERVHGANTSDVEMLRMKMEGMSKGMRERMAEYSRRLEAVASGDNAGCQSRKCGNRHS
RKASAGSQRSWSGGSTASNGNAPSALDAGPHARSRQNVAAEKRQQQHVIMSGECKLVGSA
SCRDCREIMWKIMEQVNAESDQWTEMQDMLEQVRLEMQELQSSRDTWQHRAMASDISLRS
LNSQLLEWKNRGQAYEQRAEELHRKISELESKLHTSKAHLPAPAVIPNQNQWSDACKMEH
PRGNPQHQPSKEPGKEEIKKHVLICRVKHSPSSVLPKRSPFQEIGNIRLPRHR
Download sequence
Identical sequences K7WFT1
GRMZM2G324467_P02 GRMZM2G324467_T01|PACid:20838375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]