SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G343856_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G343856_P01
Domain Number 1 Region: 282-367
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000154
Family Tropomyosin 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G343856_P01   Gene: GRMZM2G343856   Transcript: GRMZM2G343856_T01
Sequence length 442
Comment seq=translation; coord=9:121518224..121521766:1; parent_transcript=GRMZM2G343856_T01; parent_gene=GRMZM2G343856
Sequence
MAARAARSSRAGGSRLDLMRPLGSRLDLMPSSGNDHDHSGYDENKNCITHSSNMDDTNIA
DEGYNLEPATNGYPMTHVHDLDSSSADENSPPTSTGQDIVVLSDSNDDALMVLSPSAVNC
GSMHNNTGNLFPPNTPENLGVCSGETGGCPKETSFLALKEGFGDLGLPFWESHDNPGEVD
NYPANDQSKQGQVSGADFGVAANPVPLEDGHDSALQPCSMSERDSAMGLASLGADTQSCV
DVHSDKWTCVSISGRDEIMAGECKLVGSASCCDYREIVWKIMEQVKVESDQWTEMQDMLE
QVRLEMQELQASRDAWQHRAMASDISLRSLNSQVLEWKNRAQASEQRVEELHMEISELES
KLHTFKAHLPAPAAIPNQKQWSDACKMEYPRAKPQHPQSQESGKEEIKKHVLICRVKRSP
SSMLSERSPFQEIGNISLPRHR
Download sequence
Identical sequences GRMZM2G343856_T01|PACid:20840418 GRMZM2G343856_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]