SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G370780_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GRMZM2G370780_P01
Domain Number - Region: 52-112
Classification Level Classification E-value
Superfamily Tropomyosin 0.0628
Family Tropomyosin 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G370780_P01   Gene: GRMZM2G370780   Transcript: GRMZM2G370780_T01
Sequence length 250
Comment seq=translation; coord=1:69410639..69412108:1; parent_transcript=GRMZM2G370780_T01; parent_gene=GRMZM2G370780
Sequence
MKFGKRLKKQIEESLPEWRSQFLNYKELKRRVNAVSSRGSAADPSSSSAAEADFLTLLDA
EIDKFNAFFLEREEEFVIRQRELQERIGRAGGPEATLARVRREVVDLHGEMVLLLNYSSV
NYTGLAKILKKFDKRTGGVLRLPVIARVLRQPFFTTDLISELVRDCEAAMEAVFPPAASR
DLHGRQALAVAGQGIFRNTVAALLTMQEVRSGSSTVGHFSLPPMQPLPESDWLVQSVDST
PTASPLIPTQ
Download sequence
Identical sequences B6TC58
GRMZM2G370780_P01 GRMZM5G828488_T01|PACid:20865262 NP_001149241.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]