SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G373914_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GRMZM2G373914_P01
Domain Number - Region: 95-270
Classification Level Classification E-value
Superfamily Tropomyosin 0.00105
Family Tropomyosin 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G373914_P01   Gene: GRMZM2G373914   Transcript: GRMZM2G373914_T01
Sequence length 280
Comment seq=translation; coord=4:244745454..244749288:-1; parent_transcript=GRMZM2G373914_T01; parent_gene=GRMZM2G373914
Sequence
MAGILAWAADVVGGAGGSDDEADDDARAAASAAMTPAQRLRAADLDARAASLRRAIQDLR
LRVPPPHVAQRLPHLHADSLASSAALALQLNAHSSTKEQTQQREVTLQEENAAYEKAISE
CKQKIQEKQMEATQLLSNLEEMEVTEHNLKTQLENALKELEAAQHKASTATSGTAENALL
EAKSVTDLKSKDLEEKKRELELLDNKVQTLEKEWSVVEEESLKKPTPAQREKVLERQLHS
LIEQLTAKQAQAEILATDVHSKEKELERLNHLHRNLYGGA
Download sequence
Identical sequences GRMZM2G373914_P01 GRMZM2G373914_P03

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]