SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G423861_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G423861_P01
Domain Number 1 Region: 885-1233
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.63e-119
Family Motor proteins 0.000000000097
Further Details:      
 
Domain Number 2 Region: 373-490
Classification Level Classification E-value
Superfamily Second domain of FERM 5.5e-20
Family Second domain of FERM 0.0027
Further Details:      
 
Domain Number 3 Region: 495-583
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000012
Family Phosphotyrosine-binding domain (PTB) 0.051
Further Details:      
 
Domain Number 4 Region: 828-908
Classification Level Classification E-value
Superfamily Prismane protein-like 0.0000659
Family Acetyl-CoA synthase 0.023
Further Details:      
 
Weak hits

Sequence:  GRMZM2G423861_P01
Domain Number - Region: 726-831
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00246
Family Myosin rod fragments 0.0049
Further Details:      
 
Domain Number - Region: 272-321
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0589
Family First domain of FERM 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G423861_P01   Gene: GRMZM2G423861   Transcript: GRMZM2G423861_T01
Sequence length 1261
Comment seq=translation; coord=10:146727080..146740772:-1; parent_transcript=GRMZM2G423861_T01; parent_gene=GRMZM2G423861
Sequence
MAAGGVGPAQHQAANGASGSVSNGGAATPLHGSAADGYDSDGYSFAPPTPSTLSMSIPPE
LAGAIPLIDRFQVEGFLKAMQKQIHSAGKRGFFSKKSVGPQAREKFTLEDMLCFQKDPIP
TSLLKISSDLVSRSIKLFHVILKYMGVDSPAIITLDERIELVAKLYKHTLKRSELRDELF
AQISKQTRNNPDRGWSIRAWELMYLCASSMPPSKDIGAYLSEYVHFVAHGATTDSDVRVL
ALNTLNALKRSVKAGPRVTIPAREEIEALLTSRKLTTIVFFLDETFEEITYDMATTVADA
VEELASIIKLSVYSSFSLFECRKVVNGSKSSEVGNEEYIGLDDNKYIGDLLSEFRSAKDR
NKGEILHCKLVFKKRLFRESDEAVTDPMFVQLSYVQLQHDYILGNYPVGRDDASQLSALQ
ILVEIGFIDNPESCVEWISLLERFLPRQVAITRAKRDWELDIISRFQLMEHLSKDDARQQ
FLRILRTLPYGNSVFFSVRKIDDPIGLLPGKIILGINKRGVHFFRPVPKEYLHSAELRDI
MQFGSSNTAVFFKMRVAGVLHIFQFETKQGEEICVALQTHINDVMLRRYSKARSANSVTS
QNDVNHAYKPPNIEMYEKHVQELTKTVEESQKQADQLREDLQLKTKQETEMQEELEGLKD
TLQSERQSSKEVKNELDKLKSLCDEKESALQAALMEKSRLETRLTSSQGRERDTLTTVGS
VNSDIEMLTKLKEDLKSYQKELDASKQVSKKLMSEKNLLDQKVQRLERMKNEEKSTMEKV
YADECRKLKSQIAELEQKLEDATQSLNVAESNLAVRNAEVDSLQNSLKDLDELREFKADV
DRKNQQTAEILKRQGAQLVELENLYKQEQVLRKRYYNTIEDMKGKIRVFCRLRPLSDKEL
SFEEKNIVCSPDEFTIAHPWKDEKSKQHIYDRVFDANTSQEEIFEDTKYLVQSAVDGYNV
CIFAYGQTGSGKTFTIYGSDNNPGLTPRATSELFRVIKRDGNKYSFSLKTYMVELYQDNL
VDLLLPRNVKPLKLEIKKDSKGVVTVENATVVSISSIEELRAIISRGSERRHTAGTNMND
ESSRSHLILSVIIESTNLQTQSYARGKLSFVDLAGSERVKKSGSAGKQLKEAQSINKSLS
ALADVIGALSSDGQHIPYRNHKLTMLMSDSLGGNAKTLMFVNVSPAESNLEETYNSLMYA
SRVRCIVNDTSKHVAPKEIMRLKKLIAYWKEQAGKRSDEDELEEVKEERISKERADNRLT
G
Download sequence
Identical sequences K7TT98
XP_008663706.1.34533 GRMZM2G423861_P01 GRMZM2G423861_T01|PACid:20872151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]