SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AC190688.3_FGP006 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC190688.3_FGP006
Domain Number 1 Region: 21-60
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000183
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 
Weak hits

Sequence:  AC190688.3_FGP006
Domain Number - Region: 236-263
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0549
Family Hairpin loop containing domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AC190688.3_FGP006   Gene: AC190688.3_FG006   Transcript: AC190688.3_FGT006
Sequence length 381
Comment seq=translation; coord=8:168849747..168850892:1; parent_transcript=AC190688.3_FGT006; parent_gene=AC190688.3_FG006
Sequence
MELSNLTVEDLYHQALHLDRRTGNLVLLDAQNCTMWQSLDDPTDTFLRGQQRRLPVYLIA
PTTNMAASSVFYSFELDGDRIATYVNFGDTRYSYWELAPPANRTMAAARLNGSGLGMLDL
RGVTVAQITPPVKKPPVSFLALGGDGNLVMYYYDTRHQKFRASYKALGFCQLPLSCSVHE
VCSSAGKCKDFSEYADRPAARAGNASSSNPREGAGDKARMVHLRGVTTVLRTASPLANVT
LRECVVQCARNLSCNAALYVRDNAGVAAADHGVCSHYKVTAGAREVTDGSRRYSYWVKFP
EAAAGGDEEDDDSSPGTSTILMICGAIDVVCALVFVLLISLYFCRLRRQAAAVDRVVELQ
ECDGEGAREHNDTDSNGSEQT
Download sequence
Identical sequences AC190688.3_FGP006 XP_020398833.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]