SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G000620_P02 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G000620_P02
Domain Number 1 Region: 504-791
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-81
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 80-187
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.2e-26
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G000620_P02   Gene: GRMZM2G000620   Transcript: GRMZM2G000620_T02
Sequence length 836
Comment seq=translation; coord=10:143722773..143726354:1; parent_transcript=GRMZM2G000620_T02; parent_gene=GRMZM2G000620
Sequence
MAVLNLLALIIATLLLLFRRTSGAGISPADTLNSGGNVTDGETLVSAGGTFTLGFFSPST
TVLTKRYLGIWFTASGTDAVLWVANRETPLNNTSGVLVMSSRVGLRLLDGSGRTAWSSNT
TGASTSSVAQLLGSGNLVVREKSSNAVFQWQSFDHPQNTLLAGMRFGKNLKTGMEWSLTS
WRAQDDPATGDYRRVMDTKGLPDIVTWHGNAKKYRAGPWNGRWFSGVPEMDSGYKLFSVQ
MVDGPDEVTYVLNTTAGIPFTRVVLDEVGKVRVLMWLPTSRVWKEYPWLPRDACDEYTSC
GAFGLCNVDAAPTPSCSCAVGFSPVNASEWSRREASGGCQRDVPLECAAGNGTAVTDRFA
PVHGVKLPDTDNATVDMGATLEQCKARCLANCSCVAYAPADIRGGGDGSGCVMWKDNIVD
VRYIENGQDLFLRLAKSESATGERVRLAKILVPVMAFVLALTAAGMYLAWNCKLRAKRRN
RDNLRKAILGYSTAPNELGDENVELPFVSLGEIAAATNNFSEDNMLGQGGFGKVYKGTLG
QNVQVAIKRLGQCSGQGVEEFRNEAVLIAKLQHRNLVRLLGCCIDGDEKLLVYEYLPNRS
LDSIIFDAASKHLLDWPTRFKIIRGVCRGLLYLHQDSRLTIIHRDLKTSNILLDADMSPK
ISDFGMARIFGGNQHEANTNRVVGTYGYMSPEYAMDGVFSVKSDTYSFGVIVLEIISGLK
ISLTHCNGFPNLLAYAWSLWIDDRAMDLVDSSLEKSSSCSEALRCIQIGLLCVQDNPNSR
PLMSSVVTMLENESTPLAVPIQPMYFSYRGLGGTGEENNTSSSVNGMSLTTMLVGR
Download sequence
Identical sequences B6SWL2
GRMZM2G000620_P02 NP_001147960.1.34533 XP_020400628.1.34533 XP_020400629.1.34533 XP_020400630.1.34533 XP_020400631.1.34533 XP_020400632.1.34533 XP_020400633.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]