SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G041831_P03 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G041831_P03
Domain Number 1 Region: 88-367
Classification Level Classification E-value
Superfamily Mitochondrial carrier 5.36e-80
Family Mitochondrial carrier 0.000055
Further Details:      
 
Domain Number 2 Region: 15-64
Classification Level Classification E-value
Superfamily EF-hand 0.0000000451
Family Polcalcin 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G041831_P03   Gene: GRMZM2G041831   Transcript: GRMZM2G041831_T03
Sequence length 375
Comment seq=translation; coord=9:86866450..86878961:1; parent_transcript=GRMZM2G041831_T03; parent_gene=GRMZM2G041831
Sequence
MHPPRGALGRAHQGCLLSAGIEINDEELARFVEHVDKDNNGIITFEEWRDFLLLYPNEAT
IENIYHHWERVCLVDIGEQAAIPEGISKHVNASKYLIAGGIAGAASRTATAPLDRLKVIM
QVQTTRTSVMHAIKDIWTKGGMLGFFRGNGLNVVKVAPESAIRFYAYEMLKEYIMKRKGE
NKSEVGASERLIAGGLAGAVAQTAIYPIELVKTRLQTYSGEVGYVPRIGQLSRDILVHEG
PRAFYRGLVPSLLGIVPYAGIDLAVYETLKDVSKTYILKDSDPGPLVQLGCGTVSGALGA
TCVYPLQVIRTRLQAQQANSESAYRGMSDVFWRTLHHEGVSGFYKGILPNLLKVVPAASI
TYLVYEAMKKNLSLD
Download sequence
Identical sequences C0PEQ3
GRMZM2G041831_P03 GRMZM2G041831_T03|PACid:20840604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]