SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G041831_P06 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G041831_P06
Domain Number 1 Region: 182-461
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.07e-79
Family Mitochondrial carrier 0.000055
Further Details:      
 
Domain Number 2 Region: 5-182
Classification Level Classification E-value
Superfamily EF-hand 1.38e-34
Family Calmodulin-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G041831_P06   Gene: GRMZM2G041831   Transcript: GRMZM2G041831_T06
Sequence length 469
Comment seq=translation; coord=9:86866536..86883053:1; parent_transcript=GRMZM2G041831_T06; parent_gene=GRMZM2G041831
Sequence
MEHVLLALHETEAEREARIRDMFAFFDTAGSGQLDYAQIEAGLAALQVPAECKYARELLR
ACDRDRDGRVGYDDFRRYMDDKELELYRIFQAIDVEHNGCILPEELWDALIKAGIEINDE
ELARFVEHVDKDNNGIITFEEWRDFLLLYPNEATIENIYHHWERVCLVDIGEQAAIPEGI
SKHVNASKYLIAGGIAGAASRTATAPLDRLKVIMQVQTTRTSVMHAIKDIWTKGGMLGFF
RGNGLNVVKVAPESAIRFYAYEMLKEYIMKRKGENKSEVGASERLIAGGLAGAVAQTAIY
PIELVKTRLQTYSGEVGYVPRIGQLSRDILVHEGPRAFYRGLVPSLLGIVPYAGIDLAVY
ETLKDVSKTYILKDSDPGPLVQLGCGTVSGALGATCVYPLQVIRTRLQAQQANSESAYRG
MSDVFWRTLHHEGVSGFYKGILPNLLKVVPAASITYLVYEAMKKNLSLD
Download sequence
Identical sequences B8A0E7
GRMZM2G041831_T06|PACid:20840603 GRMZM2G041831_P06 NP_001146297.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]