SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G045430_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G045430_P01
Domain Number 1 Region: 528-722
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-63
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 78-177,212-243
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.21e-20
Family alpha-D-mannose-specific plant lectins 0.0048
Further Details:      
 
Weak hits

Sequence:  GRMZM2G045430_P01
Domain Number - Region: 314-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family Follistatin (FS) module N-terminal domain, FS-N 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G045430_P01   Gene: GRMZM2G045430   Transcript: GRMZM2G045430_T01
Sequence length 728
Comment seq=translation; coord=7:150516048..150522468:-1; parent_transcript=GRMZM2G045430_T01; parent_gene=GRMZM2G045430
Sequence
MVGTSPGGGVFCFSSMVSSPRLLFLLLAGASLCCVAAQKTDTLRQGESLSGAATLVSSPE
GVFEAGFFAPDPKQPSRQYLGIWYHSISPRTVVWVANRVAPATSASPSLTLTVTGELRVL
DGTAANGTADAPLLWSSNTTSRAGPRGGYSAVLQDTGSLEVRSEDGVLWDSFWHPTDTIL
SGMRITLQAPGRGPKERMLFTSWASETDPSPGRYALGLDPGNSGQAYIWKDGNVTYWRSG
QWNGVNFIGIPWRPLYRSGFTPAIDPVLGNYYTYTATNTSLQRFVVLPNGTDICYMVRKS
SQDWELVWYQPSNECEYYATCGPNAKCTASQDGKAKCTCLKGFHPKLQEQWNAGNWSQGC
IRSPPLGCETNQSGDGFLPMGNIKWPDFSYWVSTVGDEPGCRTVCLNNCSCGAYVYTATT
GCLAWGNELIDMHELQTGAYTLNLKLPASELRGHHPIWKIATIISAIVLFVLAACLLLWW
KHGRNIKDAVHGSWRSRHSSTQSQQNSAMLDISQSIRFDDDVEDGKSHELKVYSLDRIRT
ATSNFSDSNKLGEGGFGPVYMGTLPGGEEVAVKRLCRNSGQGLEEFKNEVILIAKLQHRN
LVRLLGCCIQREEKILVYEYMPNKSLDAFLFNPEKQRLLDWKKRFDIIEGIARGLLYLHR
DSRLRVVHRDLKASNILLDADMKPKISDFGMARMFGGDQNQFNTNRVVGTFGYMSPEYAM
EGIFFSQV
Download sequence
Identical sequences GRMZM2G045430_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]