SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G059299_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G059299_P01
Domain Number 1 Region: 95-185,284-306
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.77e-21
Family alpha-D-mannose-specific plant lectins 0.0064
Further Details:      
 
Weak hits

Sequence:  GRMZM2G059299_P01
Domain Number - Region: 158-303
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.000471
Family DPP6 N-terminal domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G059299_P01   Gene: GRMZM2G059299   Transcript: GRMZM2G059299_T01
Sequence length 467
Comment seq=translation; coord=8:156139051..156140533:-1; parent_transcript=GRMZM2G059299_T01; parent_gene=GRMZM2G059299
Sequence
MLQLALALCVLTAGGVVRAQPFDYPTAKPSTTWANTDASLPHHVTYADGSVARAALLRLN
PAGYGPSYAFGFFCTNHLAPLCAEFLLGVAVVYCNSGGLMTSVVAGIPQVVWSANRGSPV
GEGAAAELTAAGDLVLRSAQGAVVWSAAGTAGRSVAAMAVARDGNLLLLDARNNTVWQSF
DHPTDALLVGQSLRPGARLVANSSAANWSPSRLYLTVAADDDSLSAYVDAEPPQRYYRLG
FSGGGGGGGAYATYTNGSLAVFAAAAPAPTPLATIQLPAVGAGTVQYMRLEHDGHLRVYE
WSSAGWAPVFDVLRLFPDDCAFPTVCGAYGVCTDMQCSCPDAANFRAVDFRRPNRGCVTV
APVAGCGGSHPPARLVSLPGLAYFNDPATSLRALERVSDAACRKACLDDCACAAAQFVYG
TDAGDGFCYLQSEVLSLETSRPEVVHYNSTMHLKVRATRRPSPSARF
Download sequence
Identical sequences C0P3V1
NP_001168278.1.34533 GRMZM2G059299_T01|PACid:20852409 GRMZM2G059299_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]